SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000010205 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000010205
Domain Number 1 Region: 28-57,175-344
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.5e-60
Family G proteins 0.0000000212
Further Details:      
 
Domain Number 2 Region: 57-177
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.01e-41
Family Transducin (alpha subunit), insertion domain 0.000000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000010205
Sequence length 350
Comment (Mus musculus)
Sequence
MGAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLE
ECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMS
DIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGI
IETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMH
ESLHLFNSICNHRYFATTSIVLFLNKKDVFSEKIKKAHLSICFPDYDGPNTYEDAGNYIK
VQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
Download sequence
Identical sequences A0A2K6GJQ1 H0X739 P20612
ENSPVAP00000016120 ENSMUSP00000010205 NP_032166.1.92730 XP_005410304.1.28644 XP_006892943.1.29581 XP_006909183.1.64745 XP_008574986.1.73410 XP_011363021.1.92234 XP_012626799.1.48125 XP_012667392.1.62490 XP_016005481.1.101085 XP_016005482.1.101085 XP_019486002.1.44202 XP_019486009.1.44202 XP_019579361.1.88060 XP_019579362.1.88060 XP_020029971.1.5219 XP_021061969.1.100879 ENSPVAP00000016120 ENSOGAP00000011209 10090.ENSMUSP00000010205 ENSOGAP00000011209 ENSMUSP00000010205 ENSMUSP00000010205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]