SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000015791 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000015791
Domain Number 1 Region: 3515-3689
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.83e-24
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 2 Region: 3325-3511
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.04e-22
Family Laminin G-like module 0.0082
Further Details:      
 
Domain Number 3 Region: 3125-3296
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.37e-19
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 4 Region: 2931-3120
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000104
Family Laminin G-like module 0.0084
Further Details:      
 
Domain Number 5 Region: 2736-2919
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000238
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 6 Region: 1923-1973
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000614
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 7 Region: 1971-2026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family Laminin-type module 0.0019
Further Details:      
 
Domain Number 8 Region: 547-595
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 9 Region: 1533-1584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 10 Region: 683-731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 11 Region: 1582-1630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000165
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 12 Region: 1443-1491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000206
Family Laminin-type module 0.006
Further Details:      
 
Domain Number 13 Region: 1865-1917
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 14 Region: 364-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 15 Region: 305-366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000226
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 16 Region: 748-784
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 17 Region: 638-685
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000558
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 18 Region: 593-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000243
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 19 Region: 2025-2069
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.0066
Further Details:      
 
Domain Number 20 Region: 2081-2121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000184
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 21 Region: 500-543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000184
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 22 Region: 834-873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 23 Region: 434-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000067
Family Laminin-type module 0.023
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000015791
Domain Number - Region: 1827-1867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000114
Family Laminin-type module 0.064
Further Details:      
 
Domain Number - Region: 782-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000148
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number - Region: 111-187
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0139
Family APC10-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000015791
Sequence length 3718
Comment (Mus musculus)
Sequence
MAKRGGQLCAGSAPGALGPRSPAPRPLLLLLAGLALVGEARTPGGDGFSLHPPYFNLAEG
ARITASATCGEEAPTRSVSRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICTAANSNKAH
PVSNAIDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERS
TDFGHTYQPWQFFASSKRDCLERFGPRTLERITQDDDVICTTEYSRIVPLENGEIVVSLV
NGRPGALNFSYSPLLRDFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDIS
IGGRCVCHGHADVCDAKDPLDPFRLQCACQHNTCGGSCDRCCPGFNQQPWKPATTDSANE
CQSCNCHGHAYDCYYDPEVDRRNASQNQDNVYQGGGVCLDCQHHTTGINCERCLPGFFRA
PDQPLDSPHVCRPCDCESDFTDGTCEDLTGRCYCRPNFTGELCAACAEGYTDFPHCYPLP
SFPHNDTREQVLPAGQIVNCDCNAAGTQGNACRKDPRLGRCVCKPNFRGAHCELCAPGFH
GPSCHPCQCSSPGVANSLCDPESGQCMCRTGFEGDRCDHCALGYFHFPLCQLCGCSPAGT
LPEGCDEAGRCQCRPGFDGPHCDRCLPGYHGYPDCHACACDPRGALDQQCGVGGLCHCRP
GYTGATCQECSPGFYGFPSCIPCHCSADGSLHTTCDPTTGQCRCRPRVTGLHCDMCVPGA
YNFPYCEAGSCHPAGLAPANPALPETQAPCMCRAHVEGPSCDRCKPGYWGLSASNPEGCT
RCSCDPRGTLGGVTECQGNGQCFCKAHVCGKTCAACKDGFFGLDYADYFGCRSCRCDVGG
ALGQGCEPKTGACRCRPNTQGPTCSEPAKDHYLPDLHHMRLELEEAATPEGHAVRFGFNP
LEFENFSWRGYAHMMAIQPRIVARLNVTSPDLFRLVFRYVNRGSTSVNGQISVREEGKLS
SCTNCTEQSQPVAFPPSTEPAFVTVPQRGFGEPFVLNPGIWALLVEAEGVLLDYVVLLPS
TYYEAALLQHRVTEACTYRPSALHSTENCLVYAHLPLDGFPSAAGTEALCRHDNSLPRPC
PTEQLSPSHPPLATCFGSDVDIQLEMAVPQPGQYVLVVEYVGEDSHQEMGVAVHTPQRAP
QQGVLNLHPCPYSSLCRSPARDTQHHLAIFYLDSEASIRLTAEQAHFFLHSVTLVPVEEF
STEFVEPRVFCVSSHGTFNPSSAACLASRFPKPPQPIILKDCQVLPLPPDLPLTQSQELS
PGAPPEGPQPRPPTAVDPNAEPTLLRHPQGTVVFTTQVPTLGRYAFLLHGYQPVHPSFPV
EVLINGGRIWQGHANASFCPHGYGCRTLVLCEGQTMLDVTDNELTVTVRVPEGRWLWLDY
VLIVPEDAYSSSYLQEEPLDKSYDFISHCATQGYHISPSSSSPFCRNAATSLSLFYNNGA
LPCGCHEVGAVSPTCEPFGGQCPCRGHVIGRDCSRCATGYWGFPNCRPCDCGARLCDELT
GQCICPPRTVPPDCLVCQPQSFGCHPLVGCEECNCSGPGVQELTDPTCDMDSGQCRCRPN
VAGRRCDTCAPGFYGYPSCRPCDCHEAGTMASVCDPLTGQCHCKENVQGSRCDQCRVGTF
SLDAANPKGCTRCFCFGATERCGNSNLARHEFVDMEGWVLLSSDRQVVPHEHRPEIELLH
ADLRSVADTFSELYWQAPPSYLGDRVSSYGGTLHYELHSETQRGDIFIPYESRPDVVLQG
NQMSIAFLELAYPPPGQVHRGQLQLVEGNFRHLETHNPVSREELMMVLAGLEQLQIRALF
SQTSSSVSLRRVVLEVASEAGRGPPASNVELCMCPANYRGDSCQECAPGYYRDTKGLFLG
RCVPCQCHGHSDRCLPGSGICVGCQHNTEGDQCERCRPGFVSSDPSNPASPCVSCPCPLA
VPSNNFADGCVLRNGRTQCLCRPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNGDPN
MIFSDCDPLTGACRGCLRHTTGPHCERCAPGFYGNALLPGNCTRCDCSPCGTETCDPQSG
RCLCKAGVTGQRCDRCLEGYFGFEQCQGCRPCACGPAAKGSECHPQSGQCHCQPGTTGPQ
CLECAPGYWGLPEKGCRRCQCPRGHCDPHTGHCTCPPGLSGERCDTCSQQHQVPVPGKPG
GHGIHCEVCDHCVVLLLDDLERAGALLPAIREQLQGINASSAAWARLHRLNASIADLQSK
LRSPPGPRYQAAQQLQTLEQQSISLQQDTERLGSQATGVQGQAGQLLDTTESTLGRAQKL
LESVRAVGRALNELASRMGQGSPGDALVPSGEQLRWALAEVERLLWDMRTRDLGAQGAVA
EAELAEAQRLMARVQEQLTSFWEENQSLATHIRDQLAQYESGLMDLREALNQAVNTTREA
EELNSRNQERLKEALQWKQELSQDNATLKATLQAASLILGHVSELLQGIDQAKEDLEHLA
ASLDGAWTPLLKRMQAFSPASSKVDLVEAAEAHAQKLNQLAINLSGIILGINQDRFIQRA
VEASNAYSSILQAVQAAEDAAGQALRQASRTWEMVVQRGLAAGARQLLANSSALEETILG
HQGRLGLAQGRLQAAGIQLHNVWARKNQLAAQIQEAQAMLAMDTSETSEKIAHAKAVAAE
ALSTATHVQSQLQGMQKNVERWQSQLGGLQGQDLSQVERDASSSVSTLEKTLPQLLAKLS
RLENRGVHNASLALSANIGRVRKLIAQARSAASKVKVSMKFNGRSGVRLRTPRDLADLAA
YTALKFHIQSPVPAPEPGKNTGDHFVLYMGSRQATGDYMGVSLRNQKVHWVYRLGKAGPT
TLSIDENIGEQFAAVSIDRTLQFGHMSVTVEKQMVHEIKGDTVAPGSEGLLNLHPDDFVF
YVGGYPSNFTPPEPLRFPGYLGCIEMETLNEEVVSLYNFEQTFMLDTAVDKPCARSKATG
DPWLTDGSYLDGSGFARISFEKQFSNTKRFDQELRLVSYNGIIFFLKQESQFLCLAVQEG
TLVLFYDFGSGLKKADPLQPPQALTAASKAIQVFLLAGNRKRVLVRVERATVFSVDQDNM
LEMADAYYLGGVPPEQLPLSLRQLFPSGGSVRGCIKGIKALGKYVDLKRLNTTGISFGCT
ADLLVGRTMTFHGHGFLPLALPDVAPITEVVYSGFGFRGTQDNNLLYYRTSPDGPYQVSL
REGHVTLRFMNQEVETQRVFADGAPHYVAFYSNVTGVWLYVDDQLQLVKSHERTTPMLQL
QPEEPSRLLLGGLPVSGTFHNFSGCISNVFVQRLRGPQRVFDLHQNMGSVNVSVGCTPAQ
LIETSRATAQKVSRRSRQPSQDLACTTPWLPGTIQDAYQFGGPLPSYLQFVGISPSHRNR
LHLSMLVRPHAASQGLLLSTAPMSGRSPSLVLFLNHGHFVAQTEGPGPRLQVQSRQHSRA
GQWHRVSVRWGMQQIQLVVDGSQTWSQKALHHRVPRAERPQPYTLSVGGLPASSYSSKLP
VSVGFSGCLKKLQLDKRPLRTPTQMVGVTPCVSGPLEDGLFFPGSEGVVTLELPKAKMPY
VSLELEMRPLAAAGLIFHLGQALATPYMQLKVLTEQVLLQANDGAGEFSTWVTYPKLCDG
RWHRVAVIMGRDTLRLEVDTQSNHTTGRLPESLAGSPALLHLGSLPKSSTARPELPAYRG
CLRKLLINGAPVNVTASVQIQGAVGMRGCPSGTLALSKQGKALTQRQAKPSVSPLLWH
Download sequence
Identical sequences Q61001
ENSMUSP00000015791 NP_001074640.1.92730 ENSMUSP00000015791 10090.ENSMUSP00000015791 ENSMUSP00000015791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]