SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000017090 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000017090
Domain Number 1 Region: 43-148
Classification Level Classification E-value
Superfamily POZ domain 2.16e-31
Family Tetramerization domain of potassium channels 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000017090
Sequence length 234
Comment (Mus musculus)
Sequence
MAENHCELLPPAPSGLGAGLGGGLCRRCSAGMGALAQRPGGVSKWVRLNVGGTYFLTTRQ
TLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEE
GVLEEAEFYNITSLIKLVKDKIRERDSKISQMPVKHVYRVLQCQEEELTQMVSTMSDGWK
FEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTTSEPSEKAKILQERGSRM
Download sequence
Identical sequences A0A0R4J000
ENSMUSP00000017090 ENSMUSP00000017090 ENSMUSP00000017090 10090.ENSMUSP00000017090 NP_081284.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]