SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000021554 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000021554
Domain Number 1 Region: 10-249
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-86
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 267-389
Classification Level Classification E-value
Superfamily Spectrin repeat 4.68e-34
Family Spectrin repeat 0.000000618
Further Details:      
 
Domain Number 3 Region: 503-624
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-31
Family Spectrin repeat 0.00000366
Further Details:      
 
Domain Number 4 Region: 390-498
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-27
Family Spectrin repeat 0.0000029
Further Details:      
 
Domain Number 5 Region: 738-886
Classification Level Classification E-value
Superfamily EF-hand 6.7e-22
Family Calmodulin-like 0.032
Further Details:      
 
Domain Number 6 Region: 627-739
Classification Level Classification E-value
Superfamily Spectrin repeat 1.37e-20
Family Spectrin repeat 0.00000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000021554
Sequence length 892
Comment (Mus musculus)
Sequence
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
DGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNV
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFC
ALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERFLDIPKMLDAEDIVGTARPDEKAIMT
YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENR
VPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRM
VSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQK
DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKIC
DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT
IEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI
NGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEM
HGTLEDQLSHLRQYEKSIVNYKPKIDQLECDHQLIQEALIFDNKHTNYNMEHIRVGWEQL
LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGY
DIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDK
NYITEDELRRELPPDQAEYCIARMAPYAGPDSVPGALDYMSFSTALYGESDL
Download sequence
Identical sequences Q7TPR4
NP_598917.1.92730 ENSMUSP00000021554 10090.ENSMUSP00000021554 ENSMUSP00000021554 ENSMUSP00000021554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]