SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000022272 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000022272
Domain Number 1 Region: 12-107
Classification Level Classification E-value
Superfamily POZ domain 3.34e-32
Family Tetramerization domain of potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000022272
Sequence length 237
Comment (Mus musculus)
Sequence
MDNGDWGYMMSDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDPQGNYFIDR
DGPLFRYVLNFLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPRPLYPMDTFEEV
VELSSTRKLSKYSNPVAVIITQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFG
PCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERANENTVEHNWTFCRLARKTDD
Download sequence
Identical sequences A2RS47 Q8BNL5
ENSMUSP00000022272 ENSMUSP00000022272 ENSMUSP00000022272 ENSMUSP00000129059 NP_001292865.1.92730 NP_001292866.1.92730 NP_082058.1.92730 XP_006518168.1.92730 MmR287 10090.ENSMUSP00000022272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]