SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000023090 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000023090
Domain Number 1 Region: 33-231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.14e-40
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 2 Region: 271-335
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000628
Family VWC domain 0.018
Further Details:      
 
Domain Number 3 Region: 435-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000116
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 690-763
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000146
Family VWC domain 0.009
Further Details:      
 
Domain Number 5 Region: 488-525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000055
Family EGF-type module 0.086
Further Details:      
 
Domain Number 6 Region: 528-639
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000173
Family Growth factor receptor domain 0.011
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000023090
Domain Number - Region: 336-401
Classification Level Classification E-value
Superfamily FnI-like domain 0.000199
Family Fibronectin type I module 0.09
Further Details:      
 
Domain Number - Region: 401-444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00248
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000023090
Sequence length 858
Comment (Mus musculus)
Sequence
MHAMESRVLLRTFCVILGLGAVWGLGVDPSLQIDVLTELELGESTDGVRQVPGLHNGTKA
FLFQESPRSIKASTATAERFFQKLRNKHEFTILVTLKQIHLNSGVILSIHHLDHRYLELE
SSGHRNEIRLHYRSGTHRPHTEVFPYILADAKWHKLSLAFSASHLILHIDCNKIYERVVE
MPSTDLPLGTTFWLGQRNNAHGYFKGIMQDVHVLVMPQGFIAQCPDLNRTCPTCNDFHGL
VQKIMELQDILSKTSAKLSRAEQRMNRLDQCYCERTCTVKGTTYRESESWTDGCKNCTCL
NGTIQCETLVCPAPDCPPKSAPAYVDGKCCKECKSTCQFQGRSYFEGERNTVYSSSGMCV
LYECKDQTMKLVENIGCPPLDCPESHQIALSHSCCKVCKGYDFCSEKHTCMENSVCRNLN
DRAVCSCRDGFRALREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDD
YSCTEHDECLTNQHNCDENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGACIA
ANVCACPQGFTGPSCETDIDECSEGFVQCDSRANCINLPGWYHCECRDGYHDNGMFAPGG
ESCEDIDECGTGRHSCTNDTICFNLDGGYDCRCPHGKNCTGDCVHEGKVKHTGQIWVLEN
DRCSVCSCQTGFVMCRRMVCDCENPTVDLSCCPECDPRLSSQCLHQNGETVYNSGDTWVQ
DCRQCRCLQGEVDCWPLACPEVECEFSVLPENECCPRCVTDPCQADTIRNDITKTCLDEM
NVVRFTGSSWIKHGTECTLCQCKGSPETRAGGKNRWSSKSHPEGYGEATCVTAISEVQED
GMLHRLSGDSETTLCDLN
Download sequence
Identical sequences Q8BM06
ENSMUSP00000023090 10090.ENSMUSP00000023090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]