SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000023247 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000023247
Domain Number 1 Region: 27-109
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000000128
Family Extracellular domain of cell surface receptors 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000023247
Sequence length 134
Comment (Mus musculus)
Sequence
MDSCHTTKSCVLILLVVLLCAERAQGLECYNCLGVSLGIACKSITCPYPDAVCISQQVEL
IVDSQRRKVKNKLCFPFCPANLENMEILGTTVNVNTSCCKEDLCNAPFSTGGSTWTMTRV
LLLNLGSVFLQTLL
Download sequence
Identical sequences P35460
10090.ENSMUSP00000023247 NP_032556.1.92730 XP_006520585.1.92730 ENSMUSP00000023247 ENSMUSP00000140899 ENSMUSP00000023247 ENSMUSP00000023247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]