SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000023629 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000023629
Domain Number 1 Region: 266-454
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.64e-36
Family Laminin G-like module 0.00000661
Further Details:      
 
Domain Number 2 Region: 469-668
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.13e-26
Family Laminin G-like module 0.0000649
Further Details:      
 
Domain Number 3 Region: 41-91
Classification Level Classification E-value
Superfamily GLA-domain 5.72e-20
Family GLA-domain 0.00056
Further Details:      
 
Domain Number 4 Region: 120-248
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000738
Family Growth factor receptor domain 0.011
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000023629
Domain Number - Region: 241-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000802
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000023629
Sequence length 675
Comment (Mus musculus)
Sequence
MRVLSARFRVLLACLALVIPVSETNFLSKERASQVLVRKRRANTLFEETMKGNLERECIE
ELCNKEEAREVFENNPETDYFYPKYLGCLGAFRVGSFHAARQSANAYPDLRSCVKAISDQ
CDPIPCNEDGYLACQDGQAAFTCFCKPGWQGDRCQYDVNECKDPSNVNGGCSQICDNTPG
SYHCSCKRGFAMLPNKKDCKDLDECALKPSVCGTAVCKNIPGDFECECPDGYRYDPSSKS
CKDVDECSENMCAQLCVNFPGGYSCYCDGKKGFKLAQDQKSCEGIPVCLSLDLDKNYELL
YLAEQFAGVVLYLKFRLPDITRFSAEFDFRTYDSEGIILYAESLDHSNWLLIALRDGKIE
VQFKNEFSTQITTGGNVINNGIWNMVSVEELDDSVSIKIAKEAVMNINKLGSLFKPTDGF
LDTKIYFAGLPRKVESALIKPINPRLDGCIRGWNLMKQGALGAKEIIEGKQNKHCFLNVE
KGSYYPGSGIAQFSIDYNNVTNAEGWQMNVTLNIRPSTGTGVMLALVSGGTVPFALSLVD
SRSGTSQDIVVFVENSVVARLEAVSLCSDQQSQLKCNVNRNGLELWTPLRKDVIYSKDLQ
RQLAVLDKAMKRTVATYLGGIPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHKDI
RAHSCPSVRKIQKNF
Download sequence
Identical sequences Q08761 Q3TR66
10090.ENSMUSP00000023629 ENSMUSP00000023629 NP_035303.1.92730 ENSMUSP00000023629 ENSMUSP00000023629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]