SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000025993 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000025993
Domain Number 1 Region: 89-214,319-417,532-688
Classification Level Classification E-value
Superfamily L domain-like 3.83e-60
Family Ngr ectodomain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 1147-1336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-44
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 3 Region: 759-896
Classification Level Classification E-value
Superfamily L domain-like 1.16e-33
Family Ngr ectodomain-like 0.0085
Further Details:      
 
Domain Number 4 Region: 1006-1048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000128
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 5 Region: 924-963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000179
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 6 Region: 1083-1121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 1044-1081
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000001
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 8 Region: 965-1010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000115
Family EGF-type module 0.0084
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000025993
Domain Number - Region: 1332-1372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000145
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 1377-1411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000237
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 1422-1452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000636
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000025993
Sequence length 1531
Comment (Mus musculus)
Sequence
MALTPQRGSSSGLSRPELWLLLWAAAWRLGATACPALCTCTGTTVDCHGTGLQAIPKNIP
RNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQ
LQVLPELLFQNNQALSRLDLSENFLQAVPRKAFRGATDLKNLQLDKNRISCIEEGAFRAL
RGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFT
QCSGPASLRGLNVAEVQKGEFSCSGQGEAAGAPACTLSSGSCPAMCSCSSGIVDCRGKGL
TAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLN
SLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSL
AKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETTGARCASPRRLANKRIGQI
KSKKFRCSAKEQYFIPGTEDYHLNSECTSDVACPHKCRCEASVVECSSLKLSKIPERIPQ
STTELRLNNNEISILEATGLFKKLSHLKKINLSNNKVSEIEDGTFEGAASVSELHLTANQ
LESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNHITTISPGAFDTL
QALSTLNLLANPFNCNCHLSWLGDWLRKRKIVTGNPRCQNPDFLRQIPLQDVAFPDFRCE
EGQEEVGCLPRPQCPQECACLDTVVRCSNKHLQALPKGIPKNVTELYLDGNQFTLVPGQL
STFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLH
GNDVSTLQEGIFADVTSLSHLAIGANPLYCDCRLRWLSSWVKTGYKEPGIARCAGPPEME
GKLLLTTPAKKFECQGPPSLAVQAKCDPCLSSPCQNQGTCHNDPLEVYRCTCPSGYKGRH
CEVSLDGCSSNPCGNGGTCHAQEGEDAGFTCSCPSGFEGPTCGVDTDDCVKHACVNGGVC
VDGVGNYTCQCPLQYTGRACEQLVDFCSPDMNPCQHEAQCVGTPDGPRCECMLGYTGDNC
SENQDDCKDHKCQNGAQCVDEVNSYACLCVEGYSGQLCEIPPAPRSSCEGTECQNGANCV
DQGSRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVSTAEDNGIL
LYNGDNDHIAVELYQGHVRVSYDPGSYPSSAIYSAETINDGQFHTVELVTFDQMVNLSID
GGSPMTMDNFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTSFHGCIRNLYINNEL
QDFTKTQMKPGVVPGCEPCRKLYCLHGICQPNATPGPVCHCEAGWGGLHCDQPVDGPCHG
HKCVHGKCVPLDALAYSCQCQDGYSGALCNQVGAVAEPCGGLQCLHGHCQASATKGAHCV
CSPGFSGELCEQESECRGDPVRDFHRVQRGYAICQTTRPLSWVECRGACPGQGCCQGLRL
KRRKLTFECSDGTSFAEEVEKPTKCGCAQCA
Download sequence
Identical sequences Q80TR4
ENSMUSP00000025993 10090.ENSMUSP00000025993 ENSMUSP00000025993 ENSMUSP00000025993 NP_056563.2.92730 XP_011245502.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]