SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000027247 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000027247
Domain Number 1 Region: 7-206
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.66e-50
Family Phosducin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000027247
Sequence length 240
Comment (Mus musculus)
Sequence
MQDPNADTEWNDILRKKGILPPKESLKELEEEEAEKEEQLLQQSVVKTYEDMTLEELEEN
EDEFSEEDERAIEMYRQQRLAEWKATQLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHL
YKQGIPLCSLINHHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTVFVYREGDIKAQFI
GPLVFGGMNLTIDELEWKLSESGAIKTALEENPKKPIQDLLLSSVRGPVPMRRDSDSEDD
Download sequence
Identical sequences Q8BVF2
ENSMUSP00000027247 ENSMUSP00000027247 ENSMUSP00000027247 NP_081126.2.92730 10090.ENSMUSP00000027247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]