SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000028593 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000028593
Domain Number 1 Region: 53-106
Classification Level Classification E-value
Superfamily GLA-domain 3.36e-18
Family GLA-domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000028593
Sequence length 226
Comment (Mus musculus)
Sequence
MFPLLIVLSQLPRLTLAVPHCIRSLKDSEHAPEEVFASKEAANIFMHRRLLNNRFDLELF
TPGDLERECYEEFCSYEEAREILGDDENTIKFWQTYSIKGPTTGSDVNKEKIDVMSLLTG
LIVAGVFLVIFGLVGYYVCLTKCKRRPYPSSSANYTRTARYTPSIVFRSPEEAVLSPSTS
SEDAGLPSYEQAVALTRKHSVSPPPPYPGPARGFRVFKKSMSLPSH
Download sequence
Identical sequences Q4KL73 Q8BGN6
ENSMUSP00000028593 ENSMUSP00000028593 ENSMUSP00000028593 NP_848810.3.92730 10090.ENSMUSP00000028593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]