SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000028972 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000028972
Domain Number 1 Region: 32-105
Classification Level Classification E-value
Superfamily Prefoldin 0.00000131
Family Prefoldin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000028972
Sequence length 133
Comment (Mus musculus)
Sequence
MLSPEAERVLRYLVEVEELAEAVLSDKRQIVDLDTKRNQNREGLRALQKDLSVSEDVMVC
FGNMFIKMPHPKTKEMIQKDQEHLDKEIERLRSQLKVKVNRLFEAQGKPELKGFNLNPLS
PDEVKALKVILKG
Download sequence
Identical sequences P59048 Q3UKN2
ENSMUSP00000028972 10090.ENSMUSP00000028972 ENSMUSP00000028972 ENSMUSP00000028972 NP_849270.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]