SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000029696 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000029696
Domain Number 1 Region: 234-329
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000228
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 123-187
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000142
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000029696
Sequence length 612
Comment (Mus musculus)
Sequence
MSAGSATHPAAGGRRSKWDQPAPAPLLFLPPTAPGGEVAGSGASPGGATTAAAPSGALDA
AAAVAAKINAMLMAKGKLKPSQNAAEKLQAPGKSLTSNKSKDDLVVAEVEINDVPLTCRN
LLTRGQTQDEISRLSGAAVSTRGRFMTTEEKAKVGPGDRPLYLHVQGQTRELVDRAVNRI
KEIITNGVVKAATGTSPTFNGATVTVYHQPAPIAQLSPAINQKPSFQSGMHYVQDKLFVG
LEHAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYIS
HPKPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPGYTQPSAISSIPPQPPYYPSN
GYQSGYPVVPPPQQPVQPPYGVPSIVPPAVSLAPGVLPALPTGVPPVPTQYPITQVQPPA
STGQSPISAPFIPAAPVKTALPTGPQPQPQLPAQPQSQKRRFTEELPDERDSGLLGYQHG
PIHMTNLGTGFSSQNEIEGAGSKPASSSGKERERDRQLMPPPAFPVTGIKTESDERNGSG
ALAGSHDYPAKKMKTAEKGFGLVAYAADSSDEEEEHGGHKNASSFPQGWSLGYQYPSSQP
RAKQQMPFWMAP
Download sequence
Identical sequences Q3TCX3
ENSMUSP00000029696 ENSMUSP00000029696 10090.ENSMUSP00000029696 ENSMUSP00000029696 NP_083090.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]