SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000030285 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000030285
Domain Number 1 Region: 16-204
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-63
Family Calnexin/calreticulin 0.0001
Further Details:      
 
Domain Number 2 Region: 187-301
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 7.59e-41
Family P-domain of calnexin/calreticulin 0.000006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000030285
Sequence length 420
Comment (Mus musculus)
Sequence
MCWFFFFSLSLSPFSTDGWTKRWVQSKHQSDYGQFQLASGKFYQDKERDKGLQTTEDAKF
YALSTRFKPFSNENETLVVQFSVKHEQGIDCGGGYVKLFPAALNQEDMHSESQYYIMFGP
DICGFGNNRLQVILSHKGKYHENNKTLKCRINKDTHLYTLILRPNATYEVKIDNQKVTSG
GLEDDWDFLPPKKIKDPYARKPRKWDERQQIEDPDDKKPEDWEDSEFIPDPDAKKPDDWN
EAMDGVWEGPLIPNVKYMGEWKPRIIDNPNYQGEWIHPEIDNPKYRPDPTIGHYHNISVL
GLDLWQVKSGSIFDNFLLTNDEEFAEEVGNMTWGLRKDVEQQWRELYEEMEKQKEAEETK
KKREKERARQEDVWGLDEEDEEDAEEDDEEEAEERLKQEGSAARASLDQKEAHLDQKDEL
Download sequence
Identical sequences Q3TQS0
10090.ENSMUSP00000030285 NP_001028398.1.92730 ENSMUSP00000102239 ENSMUSP00000030285 ENSMUSP00000030285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]