SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000030878 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000030878
Domain Number 1 Region: 528-560,635-709
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.63e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000030878
Sequence length 744
Comment (Mus musculus)
Sequence
MDHAEENEIPAETQRYYVERPIFSHPVLQERLHVKDKVTESIGDKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPV
IMYCFFGTSRHISIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAM
SVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGI
FSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG
TGISAGFNLHESYSVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKT
LANKHGYQVDGNQELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLM
ILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSL
FLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQI
NAPIYYANSDLYSSALKRKTGVNPALIMGARRKAMRKYAKEVGNANVANATVVKVDAEVD
GENATKPEEEDDEVKFPPIVIKTTFPEELQRFLPQGENVHTVILDFTQVNFVDSVGVKTL
AGIVKEYGDVGIYVYLAGCSPQVVNDLTRNNFFENPALKELLFHSIHDAVLGSQVREAMA
EQEATASLPQEDMEPNATPTTPEA
Download sequence
Identical sequences Q99NH7
ENSMUSP00000030878 10090.ENSMUSP00000030878 NP_109652.3.92730 ENSMUSP00000030878 ENSMUSP00000030878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]