SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000031734 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000031734
Domain Number 1 Region: 46-243
Classification Level Classification E-value
Superfamily L domain-like 1.87e-40
Family Internalin LRR domain 0.042
Further Details:      
 
Domain Number 2 Region: 535-628
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.14e-25
Family Calponin-homology domain, CH-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000031734
Sequence length 680
Comment (Mus musculus)
Sequence
MAAAVAGPLAAGGEEAAASVSLPGSPGLPGSRSAERALEEAVATGTLNLSNRRLKHFPRG
AARSYDLSDITQADLSRNRFPEVPEAACQLVSLEGLSLYHNCLKCLNPALGNLTALTYLN
LSRNQLSSLPPYICQLPLRVLIISNNKLGALPPDISTLGSLRQLDVSSNELQSLPVELCS
LRSLRDLNVRRNQLSTLPDELGDLPLVRLDFSCNRISRIPVSFCRLRHLQVVLLDSNPLQ
SPPAQICLKGKLHIFKYLTMEAGRRGAALGDLVPSRPPSFSPCPAEDLFPGRRYDGGLDS
GFHSVDSGSKRWSGNESTDDFSELSFRISELARDPRGPRQPREDGAGDGDLEQIDFIDSH
VPGEDEDRSAAEEQLPSELSLVAGDVEKPSSSRREEPAGEERRRPDTLQLWQERERKQQQ
QSGGWGSPRKDSVLKRGIRAAGAGASAPSTQATCNGPPKSSTTQLGVSGGQGAPTPPPTS
QDPLPVSGPVTAPVPRPLGSIQRPNSFLFRSSSQSGSSPSSPESVLRPRPFPQEKELISQ
LRQVLESRLQQPLPEDLAEALANGVLLCQLANQLRPRSVPFIHVPSPAVPKLSALKSRKN
VESFLEACRKMGVPEADLCSPSDLLRGTAQGLQTVLEAVILVGGKAPLPVQPSSGLGGFL
LFYVVFMLLLYVVYTRLLGS
Download sequence
Identical sequences Q921G6
ENSMUSP00000031734 ENSMUSP00000135286 ENSMUSP00000031734 10090.ENSMUSP00000031734 ENSMUSP00000031734 ENSMUSP00000135286 NP_666276.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]