SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000040168 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000040168
Domain Number 1 Region: 79-283
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-54
Family SPRY domain 0.0000146
Further Details:      
 
Domain Number 2 Region: 37-88
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000205
Family F-box domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000040168
Sequence length 286
Comment (Mus musculus)
Sequence
MAAPGPGAGAASGGASGGGAGAGGGASAGSGSSGVGGRLPSRVLELVFSYLELSELRSCA
LVCKHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKVRAFQHAFSTNDCS
RNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKRAPM
QCQGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVILDMEDKT
LAFERGYEFLGVAFRGLPKACLYPAVSAVYGNTEVTLVYLGKPLDG
Download sequence
Identical sequences Q8K3B1
10090.ENSMUSP00000040168 ENSMUSP00000040168 ENSMUSP00000040168 ENSMUSP00000040168 NP_775615.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]