SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000041585 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000041585
Domain Number 1 Region: 16-218
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-54
Family SPRY domain 0.00000000193
Further Details:      
 
Domain Number 2 Region: 223-263
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000484
Family SOCS box-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000041585
Sequence length 264
Comment (Mus musculus)
Sequence
MGQTALARGSSSTPTSQALYSDFSPPEGLEELLSAPPPDLVAQRHHGWNPKDCSENIDVK
EGGLCFERRPVAQSTDGVRGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQADHY
AALLGSNSESWGWDIGRGKLYHQSKGLEAPQYPAGPQGEQLVVPERLLVVLDMEEGTLGY
SIGGTYLGPAFRGLKGRTLYPSVSAVWGQCQVRIRYMGERRVEEPQSLLHLSRLCVRHAL
GDTRLGQISTLPLPPAMKRYLLYK
Download sequence
Identical sequences O88838
354888 GO.79329 NP_001292979.1.92730 NP_001292980.1.92730 NP_001292981.1.92730 NP_038567.1.92730 XP_006505630.1.92730 10090.ENSMUSP00000041585 ENSMUSP00000041585 ENSMUSP00000060124 ENSMUSP00000041585 ENSMUSP00000041585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]