SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000043957 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000043957
Domain Number 1 Region: 2900-3079
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.68e-37
Family Laminin G-like module 0.00000369
Further Details:      
 
Domain Number 2 Region: 2305-2491
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.64e-34
Family Laminin G-like module 0.00073
Further Details:      
 
Domain Number 3 Region: 2710-2889
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.28e-34
Family Laminin G-like module 0.0000499
Further Details:      
 
Domain Number 4 Region: 2137-2304
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-30
Family Laminin G-like module 0.00094
Further Details:      
 
Domain Number 5 Region: 2489-2681
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.43e-29
Family Laminin G-like module 0.022
Further Details:      
 
Domain Number 6 Region: 856-909
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000248
Family Laminin-type module 0.0012
Further Details:      
 
Domain Number 7 Region: 805-858
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000268
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 8 Region: 1410-1461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 9 Region: 749-800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.0097
Further Details:      
 
Domain Number 10 Region: 277-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 11 Region: 909-955
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 12 Region: 1051-1099
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000725
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 13 Region: 1468-1518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000197
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 14 Region: 404-463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 15 Region: 1516-1563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000145
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 16 Region: 476-512
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000103
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 17 Region: 1002-1049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000206
Family Laminin-type module 0.0054
Further Details:      
 
Domain Number 18 Region: 712-751
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Laminin-type module 0.089
Further Details:      
 
Domain Number 19 Region: 958-1007
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000753
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000043957
Domain Number - Region: 334-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000162
Family Laminin-type module 0.023
Further Details:      
 
Domain Number - Region: 1368-1392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000446
Family Laminin-type module 0.048
Further Details:      
 
Domain Number - Region: 86-164
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00453
Family Fucose binding lectin 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000043957
Sequence length 3083
Comment (Mus musculus)
Sequence
MRGSGTGAALLVLLASVLWVTVRSQQRGLFPAILNLATNAHISANATCGEKGPEMFCKLV
EHVPGRPVRHAQCRVCDGNSTNPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTVTLDL
RQVFQVAYIIIKAANAPRPGNWILERSVDGVKFKPWQYYAVSDTECLTRYKITPRRGPPT
YRADNEVICTSYYSKLVPLEHGEIHTSLINGRPSADDPSPQLLEFTSARYIRLRLQRIRT
LNADLMTLSHRDLRDLDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDEEAKQLQCQCE
HNTCGESCDRCCPGYHQQPWRPGTISSGNECEECNCHNKAKDCYYDSSVAKERRSLNTAG
QYSGGGVCVNCSQNTTGINCETCIDQYYRPHKVSPYDDHPCRPCNCDPVGSLSSVCIKDD
RHADLANGKWPGQCPCRKGYAGDKCDRCQFGYRGFPNCIPCDCRTVGSLNEDPCIEPCLC
KKNVEGKNCDRCKPGFYNLKERNPEGCSECFCFGVSGVCDSLTWSISQVTNMSGWLVTDL
MSTNKIRSQQDVLGGHRQISINNTAVMQRLTSTYYWAAPEAYLGNKLTAFGGFLKYTVSY
DIPVETVDSDLMSHADIIIKGNGLTISTRAEGLSLQPYEEYFNVVRLVPENFRDFDTRRE
IDRDQLMTVLANVTHLLIRANYNSAKMALYRLDSVSLDIASPNAIDLAVAADVEHCECPQ
GYTGTSCEACLPGYYRVDGILFGGICQPCECHGHASECDIHGICSVCTHNTTGDHCEQCL
PGFYGTPSRGTPGDCQPCACPLSIDSNNFSPTCHLTDGEEVVCDQCAPGYSGSWCERCAD
GYYGNPTVPGGTCVPCNCSGNVDPLEAGHCDSVTGECLKCLWNTDGAHCERCADGFYGDA
VTAKNCRACDCHENGSLSGICHLETGLCDCKPHVTGQQCDQCLSGYYGLDTGLGCVPCNC
SVEGSVSDNCTEEGQCHCGPGVSGKQCDRCSHGFYAFQDGGCTPCDCAHTQNNCDPASGE
CLCPPHTQGLKCEECEEAYWGLDPEQGCQACNCSAVGSTSAQCDVLSGHCPCKKGFGGQS
CHQCSLGYRSFPDCVPCGCDLRGTLPDTCDLEQGLCSCSEDGGTCSCKENAVGPQCSKCQ
AGTFALRGDNPQGCSPCFCFGLSQLCSELEGYVRTLITLASDQPLLHVVSQSNLKGTIEG
VHFQPPDTLLDAEAVRQHIYAEPFYWRLPKQFQGDQLLAYGGKLQYSVAFYSTLGTGTSN
YEPQVLIKGGRARKHVIYMDAPAPENGVRQDYEVRMKEEFWKYFNSVSEKHVTHSDFMSV
LSNIDYILIKASYGQGLQQSRIANISMEVGRKAVELPAEGEAALLLELCVCPPGTAGHSC
QDCAPGYYREKLPESGGRGPRPLLAPCVPCNCNNHSDVCDPETGKCLSCRDHTSGDHCEL
CASGYYGKVTGLPGDCTPCTCPHHPPFSFSPTCVVEGDSDFRCNACLPGYEGQYCERCSA
GYHGNPRAAGGSCQTCDCNPQGSVHSDCDRASGQCVCKPGATGLHCEKCLPRHILMESDC
VSCDDDCVGPLLNDLDSVGDAVLSLNLTGVSPAPYGILENLENTTKYFQRYLIKENAKKI
RAEIQLEGIAEQTENLQKELTRVLARHQKVNAEMERTSNGTQALATFIEQLHANIKEITE
KVATLNQTARKDFQPPVSALQSMHQNISSLLGLIKERNFTEMQQNATLELKAAKDLLSRI
QKRFQKPQEKLKALKEANSLLSNHSEKLQAAEELLKEAGSKTQESNLLLLLVKANLKEFQ
EKKLRVQEEQNVTSELIAKGREWVDAAGTHTAAAQDTLTQLEHHRDELLLWARKIRSHVD
DLVMQMSKRRARDLVHRAEQHASELQSRAGALDRDLENVRNVSLNATSAAHVHSNIQTLT
EEAEMLAADAHKTANKTDLISESLASRGKAVLQRSSRFLKESVSTRRKQQGITMKLDELK
NLTSQFQESMDNIMKQANDSLAMLRESPGGMREKGRKARELAAAANESAVKTLEDVLALS
LRVFNTSEDLSRVNATVQETNDLLHNSTMTTLLAGRKMKDMEMQANLLLDRLKPLKTLEE
NLSRNLSEIKLLISRARKQVASIKVAVSADRDCIRAYQPQTSSTNYNTLILNVKTQEPDN
LLFYLGSSSSSDFLAVEMRRGKVAFLWDLGSGSTRLEFPEVSINNNRWHSIYITRFGNMG
SLSVKEASAAENPPVRTSKSPGPSKVLDINNSTLMFVGGLGGQIKKSPAVKVTHFKGCMG
EAFLNGKSIGLWNYIEREGKCNGCFGSSQNEDSSFHFDGSGYAMVEKTLRPTVTQIVILF
STFSPNGLLFYLASNGTKDFLSIELVRGRVKVMVDLGSGPLTLMTDRRYNNGTWYKIAFQ
RNRKQGLLAVFDAYDTSDKETKQGETPGAASDLNRLEKDLIYVGGLPHSKAVRKGVSSRS
YVGCIKNLEISRSTFDLLRNSYGVRKGCALEPIQSVSFLRGGYVEMPPKSLSPESSLLAT
FATKNSSGILLVALGKDAEEAGGAQAHVPFFSIMLLEGRIEVHVNSGDGTSLRKALLHAP
TGSYSDGQEHSISLVRNRRVITIQVDENSPVEMKLGPLTEGKTIDISNLYIGGLPEDKAT
PMLKMRTSFHGCIKNVVLDAQLLDFTHATGSEQVELDTCLLAEEPMQSLHREHGELPPEP
PTLPQPELCAVDTAPGYVAGAHQFGLSQNSHLVLPLNQSDVRKRLQVQLSIRTFASSGLI
YYVAHQNQMDYATLQLQEGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTEYIKRKAFMT
VDGQESPSVTVVGNATTLDVERKLYLGGLPSHYRARNIGTITHSIPACIGEIMVNGQQLD
KDRPLSASAVDRCYVVAQEGTFFEGSGYAALVKEGYKVRLDLNITLEFRTTSKNGVLLGI
SSAKVDAIGLEIVDGKVLFHVNNGAGRITATYQPRAARALCDGKWHTLQAHKSKHRIVLT
VDGNSVRAESPHTHSTSADTNDPIYVGGYPAHIKQNCLSSRASFRGCVRNLRLSRGSQVQ
SLDLSRAFDLQGVFPHSCPGPEP
Download sequence
Identical sequences F8VQ40
ENSMUSP00000043957 NP_032506.2.92730 ENSMUSP00000043957 10090.ENSMUSP00000043957 ENSMUSP00000043957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]