SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000044568 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000044568
Domain Number 1 Region: 51-144
Classification Level Classification E-value
Superfamily POZ domain 2.69e-26
Family Tetramerization domain of potassium channels 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000044568
Sequence length 289
Comment (Mus musculus)
Sequence
MVVVTGREPDSRHSDGAMSSSEAEDDFLEPATPTATQAGHGLPLLPQEFPEVVPLNIGGA
HFTTRLSTLRRYEDTMLAAMFSGRHYIPTDSEGRYFIDRDGTHFGDVLNFLRSGDLPPRE
HVRAVHKEAQYYAIGPLLEQLENMQPLKGEKVRQAFLGLMPYYKDHLERIVEIARLRAVQ
RKARFAKLKVCVFKEEMPITPYECPLLNSLRFERSESDGQLFEHHCEVDVSFGPWEAVAD
VYDLLHCLVTDLSAQGLTVDHQCIGVCDKHLVNHYYCKRPIYEFKITWW
Download sequence
Identical sequences A0A1U7R3P3 Q8BJK1
NP_766097.1.92730 XP_005080398.1.91757 XP_005344737.1.66349 XP_006971411.1.50099 10090.ENSMUSP00000044568 MmR314 ENSMUSP00000044568 ENSMUSP00000044568 ENSMUSP00000044568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]