SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000044801 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000044801
Domain Number 1 Region: 3992-4359
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.72e-98
Family Regulator of chromosome condensation RCC1 0.0042
Further Details:      
 
Domain Number 2 Region: 368-734
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.53e-94
Family Regulator of chromosome condensation RCC1 0.00071
Further Details:      
 
Domain Number 3 Region: 4487-4835
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.88e-89
Family Hect, E3 ligase catalytic domain 0.0000635
Further Details:      
 
Domain Number 4 Region: 3420-3527,3583-3703,3733-3806
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.65e-34
Family WD40-repeat 0.01
Further Details:      
 
Domain Number 5 Region: 2024-2206
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-34
Family SPRY domain 0.01
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000044801
Domain Number - Region: 1744-1866,1903-1989
Classification Level Classification E-value
Superfamily ARM repeat 0.00196
Family HspBP1 domain 0.054
Further Details:      
 
Domain Number - Region: 2742-2804
Classification Level Classification E-value
Superfamily UBA-like 0.0225
Family UBA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000044801
Sequence length 4859
Comment (Mus musculus)
Sequence
MATMVPPVKLKWLEHLNSSWITEDSESIATREGVTVLYSKLISNKEVVPLPQQVLCLKGP
QLPDFERESLSSDEQDHYLDALLSSQLALAKMVCSDSPFAGALRKRLLVLQRVFYALSNK
YHDKGKVKQQQHSPESSSGSADVHSVSERPRSSTDALIEMGVRTGLSLLFALLRQSWMMP
VSGPGLSLCNDVIHTAIEVVSSLPPLSLANESKIPPMGLDCLSQVTTFLKGVTIPNSGAD
TLGRRLASELLLGLAAQRGSLRYLLEWIEMALGASAVVYTMEKNKLLSSQEGMISFDCFM
AILMQMRRSLGSSADRSQWREPTRTSEGLCSLYEAALCLFEEVCRMASDYSRTCASPDSI
QTGDAPIVSETCEVYVWGSNSSHQLVEGTQEKILQPKLAPSFSDAQTIEAGQYCTFVIST
DGSVRACGKGSYGRLGLGDSNNQSTLKKLTFEPHRSIKKVSSSKGSDGHTLAFTTEGEVF
SWGDGDYGKLGHGNSSTQKYPKLIQGPLQGKVVVCVSAGYRHSAAVTEDGELYTWGEGDF
GRLGHGDSNSRNIPTLVKDISNVGEVSCGSSHTIALSKDGRTVWSFGGGDNGKLGHGDTN
RVYKPKVIEALQGMFIRKVCAGSQSSLALTSTGQVYAWGCGACLGCGSSEATALRPKLIE
ELAATRIVDISIGDSHCLSLSHDNEVYAWGNNSMGQCGQGNSTGPITKPKKVSGLDGIAI
QQISAGTSHSLAWTALPRDRQVVAWHRPYCVDLEESTFSHLRSFLERYCDKINSEIPPLP
FPSSREHHNFLKLCLKLLSNHLALALAGGVATSILGRQAGPLRNLLFRLMDSTVPDEIQE
VVIETLSVGATMLLPPLRERMELLHSLLPQGPDRWESLSKGQRMQLDIILTSLQDHTHVA
SLLGYSSPSDAADLSTVCMGYGNLSDQPYGSQICHPDTHLAEILMKTLLRNLGFYTDQAF
GELEKNSDKYLLGTSSSENSQPAHLHELLCSLQKQLLAFCHINNVTENSSSVALLHKHLQ
LLLPHATDIYSRSANLLKESPWNGSVGEKLRDVIYVSAAGSMLCQIVNSLLLLPVSVARP
LLSYLLDLLPPLDCLNRLLPAAALLEDQELQWPLHGGPEVIDPAGVPLPQPAQSWVWLVD
LERTIALLIGRCLGGMLQGSPVSPEEQDTAYWMKTPLFSDGVEMDTPQLDKCMSCLLEVA
LSGNEEQKPFDYKLRPEVAVYVDLALGCSKEPARSLWISMQDYAVSKDWDSATLSNESLL
DTVSRFVLAALLKHTNLLSQACGESRYQPGKSLSEVYRCVYKVRSRLLACKNLELIQTRS
SSRDRWITDNQDSADVDPQEHSFTRTIDEEAEMEELAERDREDGHPEPEDEEEEREHEVM
TAGKIFQCFLSAREVARSRDRDRMNSGAGSGVRADDPPPQSQQERRVSTDLPEGQDVYTA
ACNSVIHRCALLILGVSPVIDELQKRREEGQLQQPSVSASEGTGLMTRSESLTAESRLVH
ASPSYRLIKSRSESDLSQPESDEEGYALSGRRNVDFDLASSHRKRGPMHSQLESLSDSWT
RLKHTRDWFYNSSYSFESDFDLTKSLGVHTLIENVVSFVSGDVGNAPGFKEPEESMSTSP
QASIIAMEQQQLRAELRLEALHQILTLLSGMEEKGNVLLTGSRSSSGFQSSTLLTSVRLQ
FLAGCFGLGTVGHTGTKGESGRLHHYQDGIRAAKRNIQVEIQVAVHKIYQQLSATLERAL
QANKHHIEAQQRLLLVTVFALSVHYQPVDVSLAISTGLLNVLSQLCGTDTMLGQPLQLLP
KTGVSQLSTALKVASTRLLQILAITTGTYADKLSPKVVQSLLDLLCSQLKNLLSQTGVLF
MASFGEGEEGEEEEKKVDSSGEAEKRDFRAALRKQHAAELHLGDFLVFLRRVVSSKAIQS
KMASPKWTEVLLNIASQKCSSGIPLVGNLRTRLLALHVLEAVLPACESGVEDDQMAQVVE
RLFSLLSDCMWETPIAQAKHAIQIKEKEQEIKLQKQGELEEEDENLPIQEVSFDPEKAQC
CIVENGQILTHGSGGKGYGLASTGVTSGCYQWKFYIVKENRGNEGTCVGVSRWPVHDFNH
RTTSDMWLYRAYSGNLYHNGEQTLTLSSFTQGDFITCVLDMEARTISFGKNGEEPKLAFE
DVDAAELYPCVMFYSSNPGEKVKICDMQMRGTPRDLLPGDPICSPVAAVLAEATIQLIRI
LHRTDRWTYCINKKMMERLHKIKICIKESGQKLKKSRSVQSREENEMREEKENKEEEKGK
HNRHGLADLSEPQLRTLCIEVWPVLAVIGGVDAGLRVGGRCVHKQTGRHATLLGVVKEGS
TSAKVQWDEAEITISFPTFWSPSDTPLYNLEPCEPLLFDVARFRGLTASVLLDLTYLTGI
HEDVGKQSIKRHEKKHRHESEEKGDIEQKPESESILDVRTGLMSDDVKSQGTTSSKSENE
IASFSLEPTLPGVESQHQITEGKRKNHEHISKTHDIAQSEIRAVQLSYLYLGAMKSLSAL
LGCSKYAELLLIPKVLAENGHNSDCASSPVVHEDVEMRAALQFLMRHMVKRAVMRSPIKR
ALGLADLERAQAMIYKLVVHGLLEDQFGGKIKQEIDQQAEESDQAQQAQTPVTTSPSASS
TTSFMSSSLEDTTTATTPVTDTETVPASESPGVMPLSLLRQMFSSYPTTTVLPTRRAQTP
PISSLPASPSDEVGRRQSLTSPDSQSTRPANRTALSDPSSRLSTSPPPPAIAVPLLEMGF
SLRQIAKAMEATGARGEADAQSITVLAMWMIEHPGHEDEEEPQPSSTADSRHGATVLGSG
GKSNDPCYLQSPGDIPSADAAEMEEGFSESPDNLDHTENAASGSGPPTRGRSTVTRRHKF
DLAARTLLARAAGLYRSVQAHRNQSRREGISLQQDPGALYDFNLDEELEIDLDDEAMEAM
FGQDLTSDNDILGMWIPEVLDWPTWHVCESEDREEVVVCELCECNVVSFNQHMKRNHPGC
GRSANRQGYRSNGSYVDGWFGGECGSGNPYYLLCGSCREKYLALKTKTKTTNSERYKGQA
PDLIGKQDSVYEEDWDMLDVDEDEKLTGEEEFELLAGPLGLNDRRIVPEPVQFPDSDPLG
ASVAMVTATNSMEETLMQIGCHGSVEKSSSGRVTLGEQAAALANPHDRVVALRRVTAAAQ
VLLARTMVMRALSLLSVSGSSCSLAAGLESLGLTDIRTLVRLMCLAAAGRAGLSTSPSAI
ASTSERSRGGHSKASKPISCLAYLSTAVGCLASNTPSAAKLLVQLCTQNLISAATGVNLT
TVDDPIQRKFLPSFLRGIAEENKLVTSPNFVVTQALVALLADKGAKLRPNYDKTEIEKKG
PLELANALAACCLSSRLSSQHRQWAAQQLVRTLAAHDRDNQTAPQTLADMGGDLRKCSFI
KLEAHQNRVMTCVWCNKKGLLATSGNDGTIRVWNVTKKQYSLQQTCVFNRLEGDAEESLG
SPSDPSFSPVSWSISGKYLAGALEKMVNIWQVNGGKGLVDIQPHWVSALAWPEEGPATTW
SGESPELLLVGRMDGSLGLIEVVDVSTMHRRELEHCYRKDVSVTCIAWFSEDRPFAVGYF
DGKLLMGTKEPLEKGGIVLIDAHKETLVSMKWDPTGHILMTCAKEENVKLWGPVSGCWRC
LHSLCHPSTVNGIAWCSLPGKGSKMQLLMATGCQNGLVCVWRIPQDTTQTSMTSSEGWWD
QESNCQDGYRKSAGAKCVYQLRGHITPVRTVAFSSDGLALVSGGLGGLMNIWSLRDGSVL
QTVVIGSGAIQTTVWIPEVGVAACSNRSKDVLVVNCTAEWASANHILATCRTALKQQGVL
GLNMAPCMRAFLERLPMMLQEQYAYEKPHVVCGDQLVHSPYMQCLASLAVGLHLDQLLCN
PPVPPHHQNCLPDPTSWNPNEWAWLECFSTTIKAAEALTNGAQFPESFTVPDLEPVPEDE
LVLLMDNSKWINGMDEQIMSWATSRPEDWHLGGKCDVYLWGAGRHGQLAEAGRNVMVPAT
APSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVT
QLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCG
FKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLAVS
ADGSMVWAFGDGDYGKLGLGNSTAKSSPQKVDVLCGIGIKKVACGTQFSVALTKDGHVYT
FGQDRLIGLPEGRARNHNRPQQIPVLAGVVIEDVAVGAEHTLALASTGDVYAWGSNSEGQ
LGLGHTNHVREPTLVTVLQGKNIRQISAGRCHSAAWTAPPVPPRAPGVSVPLQLGLPDAV
PPQYGALREVSIHTVRARLRLLYHFSDLMYSSWRLLNLSPNNQNSTSHYNAGTWGIVQGQ
LRPLLAPRVYTLPMVRSIGKTMVQGKNYGPQITVKRISTRGRKCKPIFVQIARQVVKLNA
SDLRLPSRAWKVKLVGEGADDAGGVFDDTITEMCQELETGIVDLLIPSPNATAEVGYNRD
RFLFNPSACLDEHLMQFKFLGILMGVAIRTKKPLDLHLAPLVWKQLCCVPLTLEDLEEVD
LLYVQTLNSILHIEDSGITEESFHEMIPLDSFVGQSADGKMVPIIPGGNSIPLTFSNRKE
YVERAIEYRLHEMDRQVAAVREGMSWIVPVPLLSLLTAKQLEQMVCGMPEICVDVLKKVV
RYREVDEQHQLVQWLWRTLEEFSNEERVLFMRFVSGRSRLPANTADISQRFQIMKVDRPY
DSLPTSQTCFFQLRLPPYSSQLVMAERLRYAINNCRSIDMDNYMLSRNVDNAEGSDTDY
Download sequence
Identical sequences E9PZP8
ENSMUSP00000044801 10090.ENSMUSP00000044801 NP_663592.3.92730 ENSMUSP00000044801 ENSMUSP00000044801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]