SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000045828 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000045828
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily HMG-box 0.0000000288
Family HMG-box 0.0061
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000045828
Domain Number - Region: 167-254
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00667
Family Calponin-homology domain, CH-domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000045828
Sequence length 434
Comment (Mus musculus)
Sequence
MPNRRASRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSADWALLREDEKEKYSEMARE
WRAAQGKDSGPSEKQKLVSTPLRRPGMLVPKPSISPPDMSNLSIKSDQALLGGIFYFLNI
FSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFHSFIHPGEIPRGFRFHCQAASDSSHK
IPISNFEFGHDQATVLQNLYKFIHPNPGNWPPIYCKSDDRARVNWCLKRMERASEIRQDL
ELLTVEDLVVGIYQQKFLKEPSKTWVRSLLDVAMWDYSSNTRCKWHEENDILFCALAVCK
KIAYCISNSLATLFGIQLTGAHVPLQDYEASNSVTPKMVVLDAGRYQKLRVESPGFCHFN
SYNQEQRSNTSTGYYPSGVKISGPHSSVRGRGITRLLESISNSSNNIHRFSSCETSLSPY
TPQKDGYKPFSSFS
Download sequence
Identical sequences Q8BVN9
ENSMUSP00000045828 10090.ENSMUSP00000045828 ENSMUSP00000045828 NP_780505.1.92730 ENSMUSP00000045828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]