SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000047185 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000047185
Domain Number 1 Region: 39-137
Classification Level Classification E-value
Superfamily Fibronectin type III 4.33e-19
Family Fibronectin type III 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000047185
Sequence length 231
Comment (Mus musculus)
Sequence
MPLAPPANSVETMASLMPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSAT
VSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLR
GESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVI
GLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTTRQKKSPSINTIDV
Download sequence
Identical sequences B9EI95 Q3TR08
10090.ENSMUSP00000047185 NP_071869.2.92730 XP_006504107.1.92730 ENSMUSP00000047185 ENSMUSP00000047185 ENSMUSP00000047185 ENSMUSP00000127404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]