SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000047775 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000047775
Domain Number 1 Region: 509-686
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-41
Family SPRY domain 0.0004
Further Details:      
 
Domain Number 2 Region: 314-506
Classification Level Classification E-value
Superfamily Fibronectin type III 1.76e-24
Family Fibronectin type III 0.0027
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000047775
Domain Number - Region: 116-166
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000238
Family B-box zinc-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000047775
Sequence length 692
Comment (Mus musculus)
Sequence
MDLYDSEDRLQLFPGDSSRIRREVTQAEDDRELGDEFVDEHRLGTLGYPSYGMRRRDPGR
EPRDWGEAAEAEDLGYGGGQGPLDQCQDLREAYRYTHGRASEEYECYVIPEEEDEEEPAD
VFCITCKTPVRTVEKDFDTHKEHEVTPISKALEHAKDEVHKNMCKLEQQIIEMENFASHL
EEVFITVEENFGRQEQNFECHYNGILETLAQKYEEKIQALGEKKREKLEALYGQLVSCGE
NLDACRELMETVEEMCHEEKVEFLKDAVAMTDRLGKFLKTKTDVELSAQPEFEDQTLDFS
DVEQLMDAINTIPAPSAPVINPQAPNSATGSSVRVCWSLYSDDTVESYQLSYRPVQDSSS
GKDRAEFTMMVKETYCSVTNLEPNTQYEFWVIAQNRTGPSPCSEHAVYMTAPSPPSIKTE
AIRSCEEAVLICWESGNLNPVDSYTVELIQAETPEASGVTESVVGIPTCESLIQLQPRHS
YTIYVRALNVGGTSARSEPATVHTTGSYFQLNKDTCHPWLTISEDGFTVVRSEKKSFRKE
LPPSKTQFTRCVAVMGNLIPVRGRHYWEVEVAEHLDYTVGVACEDVPKQEDLGANSLSWC
MRHTFVSKRHRYEFLHNKMTPDIRITVAPRKIGVLLDYENAKLSFFNVDIAQHLYTFSCQ
LHQFVHPCFSLEKSGCLKICNGISMPKHVTFF
Download sequence
Identical sequences Q8BZ52
ENSMUSP00000047775 10090.ENSMUSP00000047775 ENSMUSP00000047775 ENSMUSP00000047775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]