SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000049804 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000049804
Domain Number 1 Region: 34-149
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.32e-19
Family Calponin-homology domain, CH-domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000049804
Sequence length 858
Comment (Mus musculus)
Sequence
PNPPEIAGAAGADGGGAPVAEEQLSGERVRYPANDKIEDINGCPKNRSQMIENIDACLNF
LAAKGINTQGLSAEEIRNGNLKAILGLFFSLSRYKQQQQQQQQQPEKQPLSSSPLPPAGS
QVAGAPSQCQAGTPQHQGLATPQAPCQLLQPVSHQQGKTQVEMQSSASSKDSSQSKIIRF
TLGQKKISRLPGPTARVAAAGSEAKTRGGSAAANNRRSQSFNNYDKSKPVTSPPPPAPPS
NHEKEPLASSASSHPGMSENVPAPLENSPSVPVNCSSSAIPQPSMTSKPWRSKSLSVKHT
ATSAMLSVKPAGPEAPRPTPEAMKPAPNNQKSMLEKLKLFNSKGGSKAGEGSASRDTSCE
RLEILPSFEETEELEATANRALSTVGPASSSPKIALKGIAQRTFSRALTNKKSSPKGNEK
EKEKQQREKEKEKEKEKGKDLTKRVSVTDRPDLKEETKADLSGVAVTEMPKKSSKIASFI
PKGGKLNSTKKEATAPSHSGIPKPGMKNVSAKSPSAPIPPKEGERSRGKLSSGLPPQKAQ
LDSRHSSSSSSLASSEGKGPGGTSLNPSISSQTVSGSVGTTQTTGSNTVSVQLPQPQQQY
NHPNTATVAPFLYRSQTDTEGNVTAESSSAGVSMEPSHYTKSGQPALEELTEDPEARRLR
TVKNIADLRQNLEETMSSLRGTQVTHSTLETTFDTNVTTEISGRSILSLTGRPTPLSWRL
GQSSPRLQAGDAPSMGNGYPPRANASRFISAEAGRYVYSAPLRRQLASRGSSICHVDVSD
KADDDVDLEGISMDAPGYMSDGDVLSKNIRSDDITSGYMTDGGLGLYTRRLNRLPDGMAV
VRETLQRNTSLGLGDADR
Download sequence
Identical sequences Q6ZPE7
10090.ENSMUSP00000049804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]