SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000051715 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000051715
Domain Number 1 Region: 23-160
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.88e-38
Family Galectin (animal S-lectin) 0.0002
Further Details:      
 
Domain Number 2 Region: 189-284
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000878
Family Galectin (animal S-lectin) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000051715
Sequence length 380
Comment (Mus musculus)
Sequence
MSTDEHLDPIPDSFILQPPVFHPVIPYGTTIFGGLYAGKMVTLQGVVPLHARRFQVDFQC
GCCLHPQPDVAFRFSPRFYTVKPHVICNTHQGGLWQKEIRWPGVALQRGDSFLILFLFEN
EEVKVSVNGQHFLHYRYRLPLSRVDTLDISGDILVKAVGFLNINPFVEGSREYPVGYPFL
LYSPRLEVPCSRALPRGLWPGQVIVVRGLVLKEPKDFTLSLKDGTTHVPVTLRASFTDRT
LAWVSSWGRKKLISAPFLFHPQRFFEVLLLCQEGGLKLALNGQGLGATSLDQKALEQAGA
QDQWKCPPTVSTAKKGQGHPRQRRGGAAATRAPQLQPILLFSREKLTWHHFVRPSSHLKG
RAHTHTHTHTHTHTHTHTHC
Download sequence
Identical sequences 10090.ENSMUSP00000051715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]