SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000053474 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000053474
Domain Number 1 Region: 160-235
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000267
Further Details:      
 
Domain Number 2 Region: 72-158
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000326
Further Details:      
 
Domain Number 3 Region: 351-426
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.8e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000657
Further Details:      
 
Domain Number 4 Region: 252-330
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.68e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000472
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000053474
Sequence length 575
Comment (Mus musculus)
Sequence
MAELVQGQSAPVGMKAEGFVDALHRVRQIAAKIDSIPHLNNSTPLVDPSVYGYGVQKRAL
DDGVGNQLGALVHQRAVITEEFKVPDKMVGFIIGRGGEQISRIQAESGCKIQIASESSGI
PERPCVLTGTPESIEQAKRLLGQIVDRCRNGPGFHNDMDGNSTIQELLIPASKVGLVIGK
GGETIKQLQERTGVKMVMIQDGPLPTGADKPLRITGDPFKVQQAREMVLEIIREKDQADF
RGVRSDFTSRAGGGSIEVSVPRFVVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGISPERA
AQVMGPPDRCQHAARIINELILTAQEREILGGLTVTRGRGRGRSDWSVGTPGGVQEITYT
VPADKCGLVIGKGGENIKSINQQSGAHVELQRNPPPNTDPNLRIFTIRGAPQQMEVARHL
IDEKVGGASLGAPAAFGQSPFSQPPAAPHQNTFPPRGFPNIAAKVNGNPHSTPVSGPPAF
LTQGWGSTYQAWQQPTQQVPSQQSQPQNSQPDYSKAWEDYYKKQSHPTSAAPQASSPPDY
TMAWAEYYRQQAAFYGQTLGQAQAHSQVCSQSPAP
Download sequence
Identical sequences Q3TIX6
ENSMUSP00000053474 ENSMUSP00000053474 10090.ENSMUSP00000053474 ENSMUSP00000123589 NP_001028561.2.92730 XP_006498189.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]