SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000055327 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000055327
Domain Number 1 Region: 5-101
Classification Level Classification E-value
Superfamily POZ domain 5.3e-26
Family Tetramerization domain of potassium channels 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000055327
Sequence length 264
Comment (Mus musculus)
Sequence
MSGQDLVTLNVGGRIFTTRPSTLKQFPASRLAGMLDGRDQEFKTVDGQIFVDRDGALFSF
ILDFLRNHELLLPSDFADHHRLQREALFYELDSLVDLLSQFLLQSRSAVMEVHFLNQNTQ
AFFRVFGSCSKTIEMLSGRITMFVERPTALTGNRNSPLALPPQRPSHHDLLFHCGSDGAA
ENQAGVRYISIKPDNRKLANGTNVLGLLVDTLLKEGFHLVSTRTPASGEKSECYVFERIT
TPQVLGMSKTPKSETTTMPAPSQK
Download sequence
Identical sequences Q2TUM3
ENSMUSP00000055327 MmR286 ENSMUSP00000055327 NP_001034194.1.92730 ENSMUSP00000055327 10090.ENSMUSP00000055327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]