SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000055969 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000055969
Domain Number 1 Region: 1-134,259-396
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.09e-65
Family CAF1-like ribonuclease 0.023
Further Details:      
 
Domain Number 2 Region: 163-248
Classification Level Classification E-value
Superfamily R3H domain 1.09e-33
Family R3H domain 0.00000863
Further Details:      
 
Domain Number 3 Region: 424-516
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.95e-16
Family Canonical RBD 0.00000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000055969
Sequence length 624
Comment (Mus musculus)
Sequence
MEIIRSNFKINLHKVYQAIEEADFFAIDGEFSGISNGPSVTALTSGFDTPEERYQKLKKH
SMDFLLFQFGLCAFKYDHTDSKHVTKSFNFYVFPKPFSRSSPDVKFVCQSSSIDFLASQG
FDFNKVFCSGIPYLNQEEERQLREQFDEKRSQANGAGALAKCPVTIPEDQKKFIDQVIEK
IEDFLQSEEKRSLELDPCTGFQRKLIYQTLSWKYPKGIHVETLETDKKERHIVISKVDEE
ERKRREQEKYTKEQEELNDAVGFSRVIHAIANSGKLVVGHNMLLDVMHTIHQFYCPLPAD
LNEFKEMAICVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFDPPKVESAEGFP
SYDTASEQLHEAGYDAYITGLCFISMANYLGSLLSPPKMCVSARSKLIEPFFNKLFLMRV
MDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQ
PEQVQIAVNTSKYAESYRIQTYAEYVGKKQKGKQVKRKWTEDSWKEVDRKRPHMQGPCYH
SNSFTAAGMLGKRTLSPDPREAALEDRESEEVSDSELEQTDSCTDPLPEGRKKSKKLKRM
KKELSLAGSVSDSPAVLFEVPDTW
Download sequence
Identical sequences A0A0R4J0P6
ENSMUSP00000055969 NP_083037.1.92730 10090.ENSMUSP00000055969 ENSMUSP00000055969 ENSMUSP00000055969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]