SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000055984 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000055984
Domain Number 1 Region: 270-469
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.32e-35
Family Pentraxin (pentaxin) 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000055984
Sequence length 482
Comment (Mus musculus)
Sequence
MRCLKKKTLLFLLIFVSLNVHRTPSQEAHPARQRKPFFERLRRLEEQFQRFQQVTLTHLQ
NIANNYNVYHNMDVRFQSLVEQSQAVALAMNQSQAAIQGDVAHLKTWYRKSQRRSQKVDA
RLQALDLSLSTKSRQWVEKEGEQKAQREAIASLALSVQALQDALASLTQQVHSQGARLAA
LEGQTQRASSGTVALGLTTAPNPTQLAQRGPGSLQLWRDRQVAKSSPQHRSSPHDVTVHV
QEMQKFQTPSSHQAAPPRTYQGPGNICNTDPVLIFPNTSTENVIFLSPGFLMPLRALSFC
SWVRMATSHLGTLLSYATKDNDNKLVLHGRNSLVPGSIHFVIGDPDFRELSLKPLLDGQW
HHICIIWTSVEGKYWLHIDRRLVATGSRFREGYEIPPGGSLVLGQEQDTVGGEFDSSEAF
VGSISGLAIWDRALLPREVANLASGKELPTGAILTLTNVTSVGGFVQRAKCTCLEQCPYA
TP
Download sequence
Identical sequences E9QNW3
ENSMUSP00000055984 10090.ENSMUSP00000055984 NP_081023.1.92730 ENSMUSP00000055984 ENSMUSP00000055984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]