SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000057515 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000057515
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily POZ domain 2.67e-24
Family BTB/POZ domain 0.0013
Further Details:      
 
Domain Number 2 Region: 381-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000544
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 331-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000232
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000057515
Domain Number - Region: 166-175
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0131
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000057515
Sequence length 459
Comment (Mus musculus)
Sequence
MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRD
QFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYLQMEHVVEKCR
NALSQFIEPKIGLKEDGVSEASLLSSVSATKSLLPPARTPKPAPKPPPPPPLPPPLLRPV
KLEFPLDEDLELKAEEEDEDEDEDVSDICIVKVESALEVAHRLKPPGSLAGGLGIGASVS
SHLGELAQSSVAPNTVTPPQGVVKACYSLSEDAEGEGLLLIPGGRASVGATSGLVEAAAV
AMAARGAGGSLGAGGSRGPLPGGFSSGNPLKNIKCTKCPEVFQGVEKLVFHMRAQHFIFM
CPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYC
DVRFAHKPAIRRHLKEQHGKTTAENVLEAGVAEINVLIR
Download sequence
Identical sequences Q9Z150
ENSMUSP00000057515 10090.ENSMUSP00000057515 ENSMUSP00000057515 ENSMUSP00000057515 NP_942589.3.92730 XP_006523953.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]