SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000057928 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000057928
Domain Number 1 Region: 308-475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-47
Family SPRY domain 0.00011
Further Details:      
 
Domain Number 2 Region: 8-85
Classification Level Classification E-value
Superfamily RING/U-box 7.07e-20
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 98-153
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000168
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000057928
Domain Number - Region: 130-204
Classification Level Classification E-value
Superfamily STAT 0.00589
Family STAT 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000057928
Sequence length 489
Comment (Mus musculus)
Sequence
MASAPSVTSLADEVNCPICQGTLREPVTIDCGHNFCRGCLTRYCEIPGPESEESLSCPLC
KEPFRPGSFRPNWQLANVVENIERLQLASTRGLEVEDACPEHGEKIYFFCEEDEAQLCVV
CRETGQHGAHTVRFLEDAAGPYREQIQKCLVCLRKEREEIQETQSRENKRIQVLLTQVAT
KRQQVISQFAHLSQFLQQQQTALLAQLEGLDGDILKQQEEFDSLATGEICRFSTLIEELE
EKNKRTARGLLTDIRSTLIRCETRKCRKPEAISPELGQRIRDFPQQAIPLRQEMKTFLEK
LCFELDYEPAHISLDPQTSHPKLLLSEDHRRARFSYKWQNSPDTPQRFDRVTCVLAQCGF
TGGRHTWMVNVDLAHGGSCTVGVVREDVRRKGELRLRPEEGIWAVRLAWGFVSALGSFPT
RLALEEQPRKVQVSLDYEVGWITFVNAVTQEHIYTFTASFTQKIFPLFGLWGRGSSFSLS
CQEGAVSLL
Download sequence
Identical sequences Q9WUH5
ENSMUSP00000057928 10090.ENSMUSP00000057928 ENSMUSP00000057928 ENSMUSP00000057928 NP_035410.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]