SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000059043 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000059043
Domain Number 1 Region: 332-453
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.76e-34
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000059043
Domain Number - Region: 56-89
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0811
Family Mitotic arrest deficient-like 1, Mad1 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000059043
Sequence length 456
Comment (Mus musculus)
Sequence
MEPSPDAEEAHTVREALGRYEAALEGAVRALHEDMQGLQRGVERRVAEALRLAGPLARTV
AELQRDNQRLQAQLERLTRQVEALGLATGVSPAPGTPSPPPAATVTDRAPRLGTARFSSH
ATFSLSGRSPSVEHDEASDLEVRRASNSCILENGHQLDAGPANGSSEVQTSSAQEPPRPR
PVSLSLRMPHQPVTAVTRVSEKFSGETSASALSPTSAAIVGGFTPSPSEAISPWTPSPTE
KSSSFTRSLSGSGYGAVTAGKRKDSPPLVTPPQSPPSSQPPAMTQAPRQGERRRELVRSQ
TLPRTSGAQARKALFEKWEQDTASKGKGETRAKLKRSQSFGVASASSIKQILLEWCRSKT
VGYQHVDLQNFSSSWSDGMAFCALVHSFFPDAFDYNALSPTQRQKNFELAFTMAENLANC
ERLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLRRFE
Download sequence
Identical sequences Q8CI12
10090.ENSMUSP00000059043 NP_808444.1.92730 ENSMUSP00000059043 ENSMUSP00000059043 ENSMUSP00000104140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]