SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000059542 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000059542
Domain Number 1 Region: 177-253
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.51e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00025
Further Details:      
 
Domain Number 2 Region: 324-398
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000468
Family Eukaryotic type KH-domain (KH-domain type I) 0.00052
Further Details:      
 
Domain Number 3 Region: 252-327
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000011
Family Eukaryotic type KH-domain (KH-domain type I) 0.00014
Further Details:      
 
Domain Number 4 Region: 2-75
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000349
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 5 Region: 73-125,153-176
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000495
Family Eukaryotic type KH-domain (KH-domain type I) 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000059542
Sequence length 469
Comment (Mus musculus)
Sequence
MKDLDHVVEDSILINRKFHHYFVMRRDQLIREMTEVYAGMIIHFTYEGKQSIRVTMKGEK
ACVEAAKKHIQHIFEPLGSHVTTQYVIPQKFYTFFMGPLCSKVQQIARDFKVQLAFPDKE
KPTTYIHPVIQEAEKEKWGKSTKEIVFSNQRKNKTILISGQIENCKAAMEALEYLIPFTA
EVQVPSHLHPYIIGPKGSGIKKIMSEFDVHTQVSQTGSNSDIISIMGLAAKVKQAKVKLE
KQINALQTEIEDRALRNFKLMFTLDAKYHSTITGHKGLFIAQICREHDVTIHFPKKANRE
IQDQITITGYKKNTLAAKDAIMRMLHKIEKTVSKEIPINPQVRDSIFGFGGKFIHKMNEQ
FHVDIRLPPKGSWNTNVSVVGLPDNVQEAIDHIFDLEKYYLSALINYDSQLESLKNTCLY
KITMESPNNSVKNDGPHSAKSYPNSSNDDSEDFPKLKQQTPSKTHPWRP
Download sequence
Identical sequences Q8BVT7
ENSMUSP00000059542 ENSMUSP00000059542 ENSMUSP00000059542 10090.ENSMUSP00000059542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]