SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000061125 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000061125
Domain Number 1 Region: 142-326
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.79e-58
Family Arfaptin, Rac-binding fragment 0.0019
Further Details:      
 
Domain Number 2 Region: 392-529
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-22
Family Galectin (animal S-lectin) 0.0078
Further Details:      
 
Domain Number 3 Region: 18-100
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-17
Family PDZ domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000061125
Sequence length 530
Comment (Mus musculus)
Sequence
MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAAL
DGTVAAGDEITGVNGKSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKK
VKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYEL
SQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLN
KAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRC
RQEARARFSQMRKDVLEKMELLDQKHGLRQCQPGHESLPMCTHGLRPTPALTAGTWRGSV
ADSDTVVKLDDGHLNNSLGSPVQADVYFPRMIVPFCGHIKGDRRPDKKALVMGILDLTPE
SFAVGLTSGDPEDPPAHVAIELEAVFTDLQLLRNSCISGERGGRAVSSRAVPYFSFIPDQ
PFRAEILCQHPQFRVFVDGHKLFDFYHCIQTVSATDTIKINGDLQITKLG
Download sequence
Identical sequences E9QAC6
ENSMUSP00000061125 10090.ENSMUSP00000061125 ENSMUSP00000061125 ENSMUSP00000018295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]