SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000063279 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000063279
Domain Number 1 Region: 295-473
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-57
Family SPRY domain 0.0000171
Further Details:      
 
Domain Number 2 Region: 35-145
Classification Level Classification E-value
Superfamily Immunoglobulin 4.41e-20
Family V set domains (antibody variable domain-like) 0.0003
Further Details:      
 
Domain Number 3 Region: 159-235
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000255
Family C1 set domains (antibody constant domain-like) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000063279
Sequence length 492
Comment (Mus musculus)
Sequence
MARAHPGDATLPSILVSFIFLQLLTSGNGKSDFLVLGPPHPLLAIVGQDKELPCKLSLNI
SAEGMELRWYRDKPSSVVHVYKNGEDVYDEQMVEYKGRTSFNGSHVARGEAAVKIHNVTV
FDNGTYHCVFKEYTSHSQATLWLKVAGRGSSPRIRVTDTQDKGIRAECTSAGWYPEPKVE
WLDLKGQPVSAESHFSVSASTGLVALLSIVTPQDTAVGGLTCSISNPLLPEKVTETYLLA
SLSRRPLSTESGPALPLILTALGLVSAAIACAFGKCHKEEHKTNQEEEDPGARDEAGLFH
VSLSLDPETASPKLMVSEDQKSVKRLLFDQDVFPSSRRFNQDPCILAQERFEAGRHYWEV
EVGDRRAWILGVCLESLVREGRIPKSPQHGLWALEFYKKKLQALSYPRTCLSPPEPLRRV
GILLDFEAGQISFYNSTNGSLIYVFSGFSFSGPLQPFFCLWTHDPRPLTICSVVTETKDT
ESSGDPGLPGDS
Download sequence
Identical sequences 10090.ENSMUSP00000063279 ENSMUSP00000063279 ENSMUSP00000124234 XP_006532595.1.92730 XP_006532596.1.92730 ENSMUSP00000020792 ENSMUSP00000063279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]