SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000064163 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000064163
Domain Number 1 Region: 21-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.13e-79
Family Calponin-homology domain, CH-domain 0.0000906
Further Details:      
 
Domain Number 2 Region: 1328-1440
Classification Level Classification E-value
Superfamily E set domains 9.34e-36
Family Filamin repeat (rod domain) 0.0000196
Further Details:      
 
Domain Number 3 Region: 1518-1636
Classification Level Classification E-value
Superfamily E set domains 5.07e-35
Family Filamin repeat (rod domain) 0.00000299
Further Details:      
 
Domain Number 4 Region: 1442-1551
Classification Level Classification E-value
Superfamily E set domains 3.4e-33
Family Filamin repeat (rod domain) 0.0000184
Further Details:      
 
Domain Number 5 Region: 1140-1249
Classification Level Classification E-value
Superfamily E set domains 3e-32
Family Filamin repeat (rod domain) 0.0000472
Further Details:      
 
Domain Number 6 Region: 452-569
Classification Level Classification E-value
Superfamily E set domains 1.4e-31
Family Filamin repeat (rod domain) 0.00075
Further Details:      
 
Domain Number 7 Region: 1856-1950
Classification Level Classification E-value
Superfamily E set domains 8.67e-31
Family Filamin repeat (rod domain) 0.00000326
Further Details:      
 
Domain Number 8 Region: 2038-2133
Classification Level Classification E-value
Superfamily E set domains 1.89e-30
Family Filamin repeat (rod domain) 0.0000174
Further Details:      
 
Domain Number 9 Region: 1061-1152
Classification Level Classification E-value
Superfamily E set domains 1.07e-29
Family Filamin repeat (rod domain) 0.00000941
Further Details:      
 
Domain Number 10 Region: 1239-1349
Classification Level Classification E-value
Superfamily E set domains 2.2e-29
Family Filamin repeat (rod domain) 0.0000158
Further Details:      
 
Domain Number 11 Region: 668-764
Classification Level Classification E-value
Superfamily E set domains 5.47e-29
Family Filamin repeat (rod domain) 0.00047
Further Details:      
 
Domain Number 12 Region: 856-967
Classification Level Classification E-value
Superfamily E set domains 2e-27
Family Filamin repeat (rod domain) 0.00066
Further Details:      
 
Domain Number 13 Region: 363-474
Classification Level Classification E-value
Superfamily E set domains 4.2e-27
Family Filamin repeat (rod domain) 0.00089
Further Details:      
 
Domain Number 14 Region: 2313-2404
Classification Level Classification E-value
Superfamily E set domains 4.74e-27
Family Filamin repeat (rod domain) 0.00000655
Further Details:      
 
Domain Number 15 Region: 764-879
Classification Level Classification E-value
Superfamily E set domains 1.2e-26
Family Filamin repeat (rod domain) 0.00077
Further Details:      
 
Domain Number 16 Region: 560-661
Classification Level Classification E-value
Superfamily E set domains 3.47e-26
Family Filamin repeat (rod domain) 0.00015
Further Details:      
 
Domain Number 17 Region: 274-370
Classification Level Classification E-value
Superfamily E set domains 1.27e-25
Family Filamin repeat (rod domain) 0.0007
Further Details:      
 
Domain Number 18 Region: 1625-1738
Classification Level Classification E-value
Superfamily E set domains 1.53e-25
Family Filamin repeat (rod domain) 0.0000589
Further Details:      
 
Domain Number 19 Region: 2504-2596
Classification Level Classification E-value
Superfamily E set domains 7.34e-25
Family Filamin repeat (rod domain) 0.00000336
Further Details:      
 
Domain Number 20 Region: 2635-2736
Classification Level Classification E-value
Superfamily E set domains 2.74e-24
Family Filamin repeat (rod domain) 0.00000385
Further Details:      
 
Domain Number 21 Region: 2411-2501
Classification Level Classification E-value
Superfamily E set domains 2.54e-23
Family Filamin repeat (rod domain) 0.00000441
Further Details:      
 
Domain Number 22 Region: 954-1055
Classification Level Classification E-value
Superfamily E set domains 5.74e-22
Family Filamin repeat (rod domain) 0.0032
Further Details:      
 
Domain Number 23 Region: 2246-2327
Classification Level Classification E-value
Superfamily E set domains 6.34e-20
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 24 Region: 1958-2053
Classification Level Classification E-value
Superfamily E set domains 1.13e-17
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 25 Region: 1792-1872
Classification Level Classification E-value
Superfamily E set domains 5e-17
Family Filamin repeat (rod domain) 0.0000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000064163
Sequence length 2737
Comment (Mus musculus)
Sequence
MMNNSNYSDASGLGLVDEADEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTD
LQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPIT
NFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVQNAREAMQQADDWLGVPQVIAPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFT
VQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNI
ERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQG
RRDTVEVALEDKGDNTFRCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVAEACNPNACRA
SGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYP
VVPGKYVVTITWGGYAIPRSPFEVQVSPEAGAQKVRAWGPGLETGQVGKSADFVVEAIGT
EVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQ
PAPPDCFPDKVKAFGPGLEPTGCIVDRPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVI
PNGDGTFRCSYVPTKPIKHTIIVSWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGL
KANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPVEADIDFDIIKNDNDTFTVKYTPPGAG
HYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLSRTGVEVGKPTHFTVLTKGAGK
AKLDVHFAGAAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVN
VAPPLDLSKVKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGG
GAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGT
PAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAH
IPGSPFKATIQPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVK
AEVLIQNNADGTYHITYSPAFPGTYTITIKYGGHPIPKFPTRVHVQPAVDTSGIKVSGPG
VEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAY
EEGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAG
TGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGQPIPGSPFRVPVKD
VVDPGKVKCSGPGLGTGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDG
THTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPSHDASKVRASGPGLNASGIPASLP
VEFTIDARDAGQGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGD
EIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVT
CTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLP
HVEEPAEMLQMRQPYAPLRPGTCPTHWATEEPVVPVEPLESMLRPFNLVIPFTVQKGELT
GEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINS
RHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYL
PTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITEGDLSQLTA
SIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIG
DASKVRVWGKGLSEGQTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVT
YCPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLK
IPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFP
AVFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKTEAAEIVEGEDSAYSVRFV
PQEMGPHTVTVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWT
REAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVV
PVASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSEL
DSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGT
TGVSSEFIVNTQNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGG
PQHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGASYSSIPKFSSDASKVV
TRGPGLSQAFVGQKNSFTVDCSKAGMFHPRGLSWGGTNMMMVGVHGPKTPCEEVYVKHMG
NRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVNVP
Download sequence
Identical sequences NYSGRC-IgSF-Q8VHX6 ENSMUSP00000064163 ENSMUSP00000064163 ENSMUSP00000087960 10090.ENSMUSP00000064163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]