SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000066461 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000066461
Domain Number 1 Region: 11-152
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.46e-47
Family Galectin (animal S-lectin) 0.0000722
Further Details:      
 
Domain Number 2 Region: 190-326
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.74e-45
Family Galectin (animal S-lectin) 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000066461
Sequence length 326
Comment (Mus musculus)
Sequence
MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADV
AFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNS
FYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQM
NTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALH
LNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDF
SHRFQAFQMVDTLEINGDITLSYVQI
Download sequence
Identical sequences A5XZ78 A5XZ79 A5XZ80 Q3UL35 Q8K419
ENSMUSP00000066461 NP_034836.1.92730 NYSGRC-LECT-ENSMUSP00000066461 ENSMUSP00000066461 ENSMUSP00000066461 10090.ENSMUSP00000066461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]