SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000066857 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000066857
Domain Number 1 Region: 34-217,299-464
Classification Level Classification E-value
Superfamily L domain-like 5.53e-63
Family Ngr ectodomain-like 0.002
Further Details:      
 
Domain Number 2 Region: 508-674,754-868
Classification Level Classification E-value
Superfamily L domain-like 8.26e-51
Family Ngr ectodomain-like 0.0014
Further Details:      
 
Domain Number 3 Region: 1142-1332
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.18e-39
Family Laminin G-like module 0.0031
Further Details:      
 
Domain Number 4 Region: 984-1111
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000157
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 912-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000034
Family EGF-type module 0.007
Further Details:      
 
Domain Number 6 Region: 955-995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000583
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 1416-1445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000226
Family EGF-type module 0.026
Further Details:      
 
Domain Number 8 Region: 1369-1406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000285
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000066857
Domain Number - Region: 1335-1366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00176
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000066857
Sequence length 1523
Comment (Mus musculus)
Sequence
MALGRTGAGAAVRARLALGLALASILSGPPAAACPTKCTCSAASVDCHGLGLRAVPRGIP
RNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSIIERGAFQDLKQLERLRLNKNK
LQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRAL
RDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTIGQFT
LCMAPVHLRGFSVADVQKKEYVCPGPHSEAPACNANSLSCPSACSCSNNIVDCRGKGLTE
IPANLPEGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSL
VLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISK
GLFVPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKS
KKFRCSGSEDYRNRFSSECFMDLVCPEKCRCEGTIVDCSNQKLARIPSHLPEYTTDLRLN
DNDISVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRM
FRGLSSLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINL
LSNPFNCNCHMAWLGRWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNEESSCQ
LSPRCPEQCTCVETVVRCSNRGLHALPKGMPKDVTELYLEGNHLTAVPKELSAFRQLTLI
DLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPE
GSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPESMADRLLLTTPT
HRFQCKGPVDINIVAKCNACLSSPCKNNGTCSQDPVEQYRCTCPYSYKGKDCTVPINTCV
QNPCEHGGTCHLSENLRDGFSCSCPLGFEGQRCEINPDDCEDNDCENSATCVDGINNYAC
LCPPNYTGELCDEVIDYCVPEMNLCQHEAKCISLDKGFRCECVPGYSGKLCETNNDDCVA
HKCRHGAQCVDEVNGYTCICPQGFSGLFCEHPPPMVLLQTSPCDQYECQNGAQCIVVQQE
PTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDKDNGILLYKGD
NDPLALELYQGHVRLVYDSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPK
SLGKLQKQPAVGSNSPLYLGGIPTSTGLSALRQGADRPLGGFHGCIHEVRINNELQDFKA
LPPQSLGVSPGCKSCTVCRHGLCRSVEKDSVVCECHPGWTGPLCDQEARDPCLGHSCRHG
TCMATGDSYVCKCAEGYGGALCDQKNDSASACSAFKCHHGQCHISDRGEPYCLCQPGFSG
HHCEQENPCMGEIVREAIRRQKDYASCATASKVPIMECRGGCGSQCCQPIRSKRRKYVFQ
CTDGSSFVEEVERHLECGCRACS
Download sequence
Identical sequences Q9WVB4
ENSMUSP00000066857 NP_035542.2.92730 ENSMUSP00000066857 10090.ENSMUSP00000066857 ENSMUSP00000066857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]