SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000069247 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000069247
Domain Number 1 Region: 51-105
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 1.22e-16
Family Ovomucoid domain III-like 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000069247
Sequence length 105
Comment (Mus musculus)
Sequence
MKVAGVFLLLSLALLCFFSGAFSQGGQDKRGWITRSEGRFPGKGVLRHRLFQINCGEFRD
PKVFCTRESDPLCGSDGQTYGNKCAFCKALEKSSGKINLKHRGKC
Download sequence
Identical sequences G3V7Q1 Q8BT20
NP_001013819.1.92730 XP_003749241.1.100692 XP_003751820.1.100692 XP_003752092.1.100692 XP_021070719.1.100879 10090.ENSMUSP00000069247 10116.ENSRNOP00000017489 ENSMUSP00000069247 ENSRNOP00000017489 ENSMUSP00000069247 ENSRNOP00000017489 ENSRNOP00000065400 ENSRNOP00000066660 ENSMUSP00000069247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]