SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000071881 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000071881
Domain Number 1 Region: 26-96
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000351
Family Eukaryotic type KH-domain (KH-domain type I) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000071881
Sequence length 118
Comment (Mus musculus)
Sequence
MMVTLVTRKDIPPWVKVPEDLKDPEVFQVQSLVLKYLFGPQGSRMSHIEQVSQAMFELKN
LESPEELIEVFIYGSQNNKIRAKWMLQSMAERYHLRQQKGVLKLEESMKTLELGQCIE
Download sequence
Identical sequences Q9CQS7
ENSMUSP00000071881 10090.ENSMUSP00000071881 ENSMUSP00000071881 ENSMUSP00000071881 NP_079550.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]