SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000074639 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000074639
Domain Number 1 Region: 288-462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.73e-48
Family SPRY domain 0.0000252
Further Details:      
 
Domain Number 2 Region: 9-89
Classification Level Classification E-value
Superfamily RING/U-box 6.6e-22
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 94-154
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.75e-17
Family B-box zinc-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000074639
Sequence length 477
Comment (Mus musculus)
Sequence
MDAVELARRLQEEATCSICLDYFTDPVMTACGHNFCRECIQMSWEKGKVKKGKKKQKGSF
PCPECREMSPQRNLRPNRLLTKVAEMARQHPGLQKRDLCQAHQEPLKLFCQDDQSPICVV
CREAQEHRMHRVLPLDEAAREYKLKLEEDIKYLREEMMKTETLQAKEEQTLTEWQERVKE
RRERILEEFQKVVLFLVEEERRILQVLKKEEEDTLGKLQDSKASLDHQSRSLDLILLQLE
ERSQQEPLQMLQDVKDTLNRKESFSVQYPEVVLPAAIKTLCRVPGQIEVLKSFQEDVMPD
PSSAYPYLLLYESRQRRYLSPPPEGSAPYSKDRFVAYPCAVGQKSFSSGRHYWEVGMNLT
GDALWALGVCRDNVSRKDRVLKSPENGFWVVQLSKGKKQLSLLPNSTLVTLTEPPSHMGI
FLDFQAGEVSFYSVNDGSHLHSFSQAAFPGPLLPFFCLGAPKSGQMVISTVTMWVKG
Download sequence
Identical sequences Q7TPM3
10090.ENSMUSP00000074639 ENSMUSP00000074639 NP_112449.1.92730 XP_006533874.1.92730 XP_006533875.1.92730 XP_011247459.1.92730 ENSMUSP00000074639 ENSMUSP00000074639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]