SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000078460 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000078460
Domain Number 1 Region: 107-186
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000112
Further Details:      
 
Domain Number 2 Region: 202-294
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.74e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000128
Further Details:      
 
Domain Number 3 Region: 396-487
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.000016
Further Details:      
 
Domain Number 4 Region: 295-386
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000078460
Sequence length 672
Comment (Mus musculus)
Sequence
MADYSTVPPPSSGSAGGGGGGVVNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGYGGQK
RPLEDGDGSWTNPSSTTHWEGMPSPFKDQPDAKKVPPQNDSFGAQLPPMHQQQSRSVMTE
EYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGGLPERSCMLTGTPESVQSAKRL
LDQIVEKGRPAPGFHHGDGPGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIQ
DGPQNTGADKPLRITGDPYKVQQAKEMVLELIRDQGGFREVRNEYGSRIGGNEGIDVPIP
RFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTPDRIAQITGPPDRCQHAAEIITDLL
RSVQAGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSIS
QQSGARIELQRSPPPNADPNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPH
GVPGPHGPPGPPGPGTPMGPYNPAPYNPGPPGPAPHGPPAPYAPQGWGNAYPHWQQQAPP
DPAKAGADPNSAAWAAYYAHYYQQQAQPPPAAPAGAPATTQTNGQGDQQAPAPAGQVDYT
KAWEEYYKKMGQAVPAPAGAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPPAPQG
FANHARSHHHLY
Download sequence
Identical sequences 10090.ENSMUSP00000078460 ENSMUSP00000078460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]