SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000079140 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000079140
Domain Number 1 Region: 370-502
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-24
Family SPRY domain 0.001
Further Details:      
 
Domain Number 2 Region: 33-144
Classification Level Classification E-value
Superfamily Immunoglobulin 9.37e-23
Family V set domains (antibody variable domain-like) 0.00026
Further Details:      
 
Domain Number 3 Region: 119-233
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000181
Family C1 set domains (antibody constant domain-like) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000079140
Sequence length 509
Comment (Mus musculus)
Sequence
MMKGSPSVPPAGCLLPLLLLLFTGVSGEVSWFSVKGPAEPITVLLGTEATLPCQLSPEQS
AARMHIRWYRAQPTPAVLVFHNGQEQGEVQMPEYRGRTQMVRQAIDMGSVALQIQQVQAS
DDGLYHCQFTDGFTSQEVSMELRVIGLGSAPLVHMTGPENDGIRVLCSSSGWFPKPKVQW
RDTSGNMLLSSSELQTQDREGLFQVEVSLLVTDRAIGNVICSIQNPMYDQEKSKAILLPE
PFFPKTCPWKVALVCSVLILLVLLGGISLGIWKEHQVKRREIKKWSKEHEEMLLLKKGTK
SVLKIRDDLQADLDRRKALYKEDWKKALLYPDWRKELFQEAPVRINYEMPDQDKTDSRTE
ENRGEETVSSSQVDHNLITLSQEGFMLGRYYWEVDVKDTEEWTLGVYELCTQDASLTDPL
RKFRVLEKNGDGYRALDFCSQNINSEEPLQLKTRPLKIAIFLDQEDNDLSFYNMTDETHI
FSFAQVPFLGSPYPYFTRNSMGLSATAQP
Download sequence
Identical sequences Q7TST0
ENSMUSP00000079140 ENSMUSP00000079140 10090.ENSMUSP00000079140 NP_001104564.1.92730 ENSMUSP00000079140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]