SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000080194 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000080194
Domain Number 1 Region: 127-318
Classification Level Classification E-value
Superfamily vWA-like 4.75e-61
Family Integrin A (or I) domain 0.0000699
Further Details:      
 
Domain Number 2 Region: 1167-1378
Classification Level Classification E-value
Superfamily vWA-like 8.58e-58
Family Integrin A (or I) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 2305-2504
Classification Level Classification E-value
Superfamily vWA-like 2.37e-56
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 4 Region: 432-617
Classification Level Classification E-value
Superfamily vWA-like 3.56e-56
Family Integrin A (or I) domain 0.00017
Further Details:      
 
Domain Number 5 Region: 2521-2724
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-33
Family Laminin G-like module 0.051
Further Details:      
 
Domain Number 6 Region: 634-803
Classification Level Classification E-value
Superfamily Fibronectin type III 6.46e-27
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 7 Region: 1940-2106
Classification Level Classification E-value
Superfamily Fibronectin type III 6.61e-23
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 8 Region: 1756-1926
Classification Level Classification E-value
Superfamily Fibronectin type III 1.53e-22
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 9 Region: 26-120,325-422
Classification Level Classification E-value
Superfamily Fibronectin type III 1.79e-22
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 10 Region: 815-986
Classification Level Classification E-value
Superfamily Fibronectin type III 1.02e-21
Family Fibronectin type III 0.00078
Further Details:      
 
Domain Number 11 Region: 1387-1563
Classification Level Classification E-value
Superfamily Fibronectin type III 5.54e-21
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 12 Region: 1568-1727
Classification Level Classification E-value
Superfamily Fibronectin type III 6.64e-21
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 13 Region: 2119-2204
Classification Level Classification E-value
Superfamily Fibronectin type III 1.34e-18
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 14 Region: 1002-1176
Classification Level Classification E-value
Superfamily Fibronectin type III 5.3e-18
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 15 Region: 2209-2292
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000285
Family Fibronectin type III 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000080194
Sequence length 3068
Comment (Mus musculus)
Sequence
MQTRLPRALAALGVALLLSSIEAEVDPPSDLNFKIIDENTVHMSWERPVDPIVGYRITVD
PTTDGPTKEFTLAASTTETLLSDLIPETQYVVTITSYNEVEESVPVIGQLTIQTGGPTKP
GEKKPGKTEIQKCSVSAWTDLVFLVDGSWSVGRNNFKYILDFIVALVSAFDIGEEKTRVG
VVQYSSDTRTEFNLNQYYRREDLLAAVKKIPYKGGNTMTGDAIDYLVKNTFTESAGSRAG
FPKVAIIITDGKSQDEVEIPARELRNIGVEVFSLGIKAADAKELKQIASTPSLNHVFNVA
NFDAIVDIQNEIISQVCSGVDEQLGELVSGEEVIEPPSNLVVTELSSKYIRLSWDPSPSA
VTGYKILLTPMAAGSRHHALSVGPQTTTLNVRDLTADTEYQISVFAMKGLTSSEPTSVME
KTQPMKVQVECSRGVDIKADIVFLVDGSYSIGIANFVKVRAFLEVLAKSFEISPNRVQIS
LVQYSRDPHTEFTLKEFNRVEDIIKAINTFPYRGGSTNTGKAMTYVREKIFVPNKGSRSN
VPKVMILITDGKSSDAFRDPAIKLRNSDVEIFAVGVKDAVRSELEAIASPPAETHVFTVE
DFDAFQRISFELTQSICLRIEQELAAIKKKAYVPPKDLRFTQVTANSFKAEWSPPGDNVF
SYHVTYKDANGDDEVTVVEPASSTSVVLNNLRPETLYLVNVTAEYEDGFSVPITGEETTA
EVKGVPRNLKVTDETTDSFKLTWSQAPGRVLRYRIRYRPVSGGESKEVSTPANQRRKTLE
NLTPDTKYEISVIAEYSSGPGSPLTGNAATEEVRGNPRDLRVSDATTSTLKLSWSRAPGK
VKQYLVTYTPAAGGETQEVTVRGDTTTTMLRKLKEGTQYDLSVTALYASGAGEALSGKGS
TLEERGSPQNLVTKDITDTSIGAYWTSAPGMVRGYRVSWKSLYDDIEAGETTLPGDAIHT
MIENLQPETKYKISVFATYSSGEGEPVTGDATTELSQDSKILRVDEETEHTMRVTWKAAP
GKVVNYRVVYRPQGGGRQMVAKVPPTVTSTVLKRLQPQTTYDITVLPMYKTGEGKLRQGS
GTTASRFKSPRNLKTSDPTMSSFRVTWEPAPGEVKGYKVTFHPTGDDRRLGELVLGPYDN
TVVLEELRAGTTYRVNVFGMFDGGESLPLVGQEMTTLSDTTVTPFLSSGMDCLTRAEADI
VLLVDGSWSIGRANFRTVRSFISRIVEVFEIGPKRVQIALAQYSGDPRTEWQLNAHRDKK
SLLQAVANLPYKGGNTLTGMALNFIRQQSFKTQAGMRPRARKIGVLITDGKSQDDVEAPS
KKLKDEGVELFAIGIKNADEVELKMIATDPDDTHAYNVADFESLSKIVDDLTINLCNSVK
GPGDLEAPTNLVISERTHRSFRVSWTPPSDSVDRYKVEYYPVSGGKRQEFYVSRLDTSTV
LKDLKPETDYVVNVYSVVEDEYSEPLKGTEKTLPVPVVSLNIYDVGPTTMHVQWQPVGGA
TGYTVSYQPTRSPEGTKPKEMRVGPTVNDVQLTGLLPNTEYEVTVQAVLYDLTSEPAKAR
EVTLPLPRPQDVKLRDVTHSTMNVVWEPVLGKVRKYIVRYKTPDEEFKEVEVDRSRASTI
LKDLSSQTQYTVSVSAVYDEGTSPPATAYDTTRRVPAPTNLQFTEVTPESFRGTWDHGAS
DVSLYRITWAPVGNPDKMETILNGDENTLVFENLNPNTPYEVSITAIYPDESESEDLSGT
ERTLRLIPLTTQAPKSGPRNLQVYNATSNSLTVKWDPASGRVQKYRITYQPSTGEGNEQT
ITVGGRQNSVLLQKLKPDTPYTITVYSQYPDGEGGRMTGRGKTKPLNTVRNLRVYDPSTS
SLSVRWDHAEGNPRQYKLFYAPTSGGPEELVPIPGNTNYAILRNLQPDTPYTITVVPVYT
EGDGGRTSDTGRTLVRGLARNIQVYNPTPNSLDVRWDPAPGPVQQYRIVYSPVAGTRPSE
SIVVPGNTRTVHLERLIPDTPYSVNIVALYSDGEGNPSPSQGRTLPRSGPRNIRVFGETT
NSLSVAWDHADGPVQQYRIIYSPTVGDPIDEYTTVPGRRNNVILQPLQPDTPYKITVIAI
YEDGDGGHLTGNGRTVGLLPPQNIHIFDEWYTRFRVSWDPSPSPVLGYKIVYKPVGSNEP
MEAFVGEVTSYTLHNLNPSTTYDVSVYAQYDSGLSVPLTDQGTTLYLNVTDLKTYQVGWD
TFCVKWSPHRAATSYRLKLSPADGTRGQEITVRGSETSHCFTGLSPEAEYGVTVFVQTPN
LEGPGVPIKEQTTVKPTEAPTEPPTPSPPPTIPPARDVCKGAKADIVFLTDASWSIGDDN
FNKVVKFIFNTVGAFDEVNPAGIQVSFVQYSDEVKSEFKLNTYNDKALALGALQNIRYRG
GNTRTGKALTFIKEKVLTWESGMRKNVPKVLVVVTDGRSQDEVKKAAFVIQQSGFSVFVV
GVADVDYNELANIASKPSERHVFIVDDFESFEKIEDNLITFVCETATSSCPLIYLDGYTS
PGFKMLEAYNLTEKNFASVQGVSLESGSFPSYSAYRLQKNAFINQPTAELHPNGLPPSYT
IILLFRLLPETPSDPFAIWQITDRDYRPQVGVIADPSSKTLSFFNKDTRGEVQTVTFDTD
EVKTLFYGSFHKVHIVVTSKSVKIYIDCYEIIEKDIKEAGNITTDGYEILGKLLKGERKS
ATFQIQSFDIVCSPVWTSRDRCCDIPSRRDEAKCPALPNACTCTQDSVGPPGPPGPAGGP
GAKGPRGERGINGAVGPPGPRGDTGPPGPQGPPGPQGPNGLSIPGEQGRQGMKGDAGEPG
LPGRTGTPGLPGPPGPMGPPGDRGFTGKDGAMGPRGPPGPPGSPGSPGVTGPSGKPGKPG
DHGRPGQSGLKGEKGDRGDIASQNMMRAVARQVCEQLISGQMSRFNQMLNQIPNDYHSSR
NQPGPPGPPGPPGSAGARGEPGPGGRPGFPGTPGMQGPPGERGLPGEKGERGTGSQGPRG
PPGPPGPQGESRTGPPGSTGSRGPPGPPGRPGNSGIRGPPGPPGYCDSSQCASIPYNGQG
YPGMLLPS
Download sequence
Identical sequences 10090.ENSMUSP00000080194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]