SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000080550 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000080550
Domain Number 1 Region: 30-213
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-38
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 2 Region: 267-333
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000023
Family VWC domain 0.013
Further Details:      
 
Domain Number 3 Region: 476-584
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000022
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 4 Region: 682-754
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000115
Family VWC domain 0.029
Further Details:      
 
Domain Number 5 Region: 427-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000342
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 589-631
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000119
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 334-391
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000921
Family VWC domain 0.038
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000080550
Domain Number - Region: 392-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00528
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 765-802
Classification Level Classification E-value
Superfamily FnI-like domain 0.0157
Family VWC domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000080550
Sequence length 810
Comment (Mus musculus)
Sequence
MPMDVILVLWFCVCTARTVLGFGMDPDLQMDIITELDLVNTTLGVTQVAGLHNASKAFLF
QDVQREIHSAPHVSEKLIQLFRNKSEFTFLATVQQKPSTSGVILSIRELEHSYFELESSG
PREEIRYHYIHGGKPRTEALPYRMADGQWHKVALSVSASHLLLHVDCNRIYERVIDPPET
NLPPGSNLWLGQRNQKHGFFKGIIQDGKIIFMPNGFITQCPNLNRTCPTCSDFLSLVQGI
MDLQELLAKMTAKLNYAETRLGQLENCHCEKTCQVSGLLYRDQDSWVDGDNCRNCTCKSG
AVECRRMSCPPLNCSPDSLPVHISGQCCKVCRPKCIYGGKVLAEGQRILTKTCRECRGGV
LVKITEACPPLNCSEKDHILPENQCCRVCRGHNFCAEAPKCGENSECKNWNTKATCECKN
GYISVQGNSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCIPGYIRVDDFSCTEHDDC
GSGQHNCDKNAICTNTVQGHSCTCQPGYVGNGTVCKAFCEEGCRYGGTCVAPNKCVCPSG
FTGSHCEKDIDECAEGFVECHNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCIDIDEC
ALRTHTCWNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKHNGQVWILREDRCSVCSCK
DGKIFCRRTACDCQNPNVDLFCCPECDTRVTSQCLDQSGQKLYRSGDNWTHSCQQCRCLE
GEADCWPLACPSLSCEYTAIFEGECCPRCVSDPCLADNIAYDIRKTCLDSSGISRLSGAV
WTMAGSPCTTCQCKNGRVCCSVDLVCLENN
Download sequence
Identical sequences Q2VWQ2
ENSMUSP00000080550 ENSMUSP00000080550 10090.ENSMUSP00000080550 NP_001032995.1.92730 ENSMUSP00000080550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]