SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000086363 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000086363
Domain Number 1 Region: 61-299
Classification Level Classification E-value
Superfamily L domain-like 5.44e-39
Family Ngr ectodomain-like 0.02
Further Details:      
 
Domain Number 2 Region: 591-705
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.51e-28
Family Calponin-homology domain, CH-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000086363
Sequence length 709
Comment (Mus musculus)
Sequence
MATPGSEPQAFAPALSVTALHPHLHQHHQHHQHHQHHGGTGGTGFNLPLNRGLERALEEA
ANSGGLNLSARKLKEFPRTTAPGHDLSDTVRADLSKNRLVEVPMELCQFVSLEILNLYHN
CIRVIPEAIVNLQMLTHLNLSRNQLSALPACLCGLPLKVLIASNNKLGSLPEEIGQLKQL
MELDVSCNEITALPQQIGQLKSLRELNVRRNYLKVLPPELVDLPLVKFDFSCNKVLVIPV
CFREMKQLQVLLLENNPLQSPPAQICTKGKVHIFKYLSIQACQIKTSDSLYLPTIERPHL
HQHVEDSKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNAPMSNIVEEDQTIKEDACHRLT
PTKGEFQPKPSILGDSGISGQEREQLAGRADARHSGLMNYIKDQAEDCEELLRIEEDAHW
HMEELLNSSKDRELDIAMIEQLREAELLQDPNGLSADIIERSILNLFPMDSGEASEFPDP
SLNGQLQLETSPDREVQNDLMLQSNGSQYSPNEIRENSPSVSPTANITAPFGLKPRSGSW
CPEEVQGSLQAESSPRRPQLLSRHVFLRPQRNLESIDPQFTIRRKMEQMREEKELVEQLR
ESIEMRLKVTLHEDLGAALMDGVVLCHLANHVRPRSVASIHVPSPAVPKLSMAKCRRNVE
NFLEACRKLGVPEEKLCLPHHILEEKGLVKVGTTVQALLDVTVTKALFT
Download sequence
Identical sequences P62046
ENSMUSP00000086363 NP_001028611.2.92730 10090.ENSMUSP00000086363 ENSMUSP00000086363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]