SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000088046 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000088046
Domain Number 1 Region: 1348-1576
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.21e-39
Family Laminin G-like module 0.0038
Further Details:      
 
Domain Number 2 Region: 393-505
Classification Level Classification E-value
Superfamily Cadherin-like 7e-31
Family Cadherin 0.00056
Further Details:      
 
Domain Number 3 Region: 809-921
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-28
Family Cadherin 0.00069
Further Details:      
 
Domain Number 4 Region: 1598-1791
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-28
Family Laminin G-like module 0.032
Further Details:      
 
Domain Number 5 Region: 498-603
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-28
Family Cadherin 0.00081
Further Details:      
 
Domain Number 6 Region: 283-391
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-26
Family Cadherin 0.00071
Further Details:      
 
Domain Number 7 Region: 178-281
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-26
Family Cadherin 0.00083
Further Details:      
 
Domain Number 8 Region: 909-1024
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-26
Family Cadherin 0.00088
Further Details:      
 
Domain Number 9 Region: 700-807
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 10 Region: 603-704
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-21
Family Cadherin 0.00097
Further Details:      
 
Domain Number 11 Region: 1017-1119
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000157
Family Cadherin 0.0079
Further Details:      
 
Domain Number 12 Region: 1288-1327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000218
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 1924-1964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000393
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 14 Region: 1830-1876
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000503
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 1794-1829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000559
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000088046
Domain Number - Region: 1267-1292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00222
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 2427-2638
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0494
Family Rhodopsin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000088046
Sequence length 2919
Comment (Mus musculus)
Sequence
MRSRAASAPLPTPLLPLLLLLLLLPPSPLLGDQVGPCRSLGSGGRSSSGACAPVGWLCPA
SASNLWLYTSRCRESGIELTGHLVPHHDGLRVWCPESGAHIPLPPSSEGCPWSCRLLGIG
GHLSPQGTLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGEGSPEESLGGRRKRNVNTAPQ
FQPPSYQATVPENQPAGTSVASLRAIDPDEGEAGRLEYTMDALFDSRSNHFFSLDPITGV
VTTAEELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTDTNDHDPVFEQQEYKESLRE
NLEVGYEVLTVRATDGDAPPNANILYRLLEGAGGSPSDAFEIDPRSGVIRTRGPVDREEV
ESYKLTVEASDQGRDPGPRSSTAIVFLSVEDDNDNAPQFSEKRYVVQVREDVTPGAPVLR
VTASDRDKGSNALVHYSIMSGNARGQFYLDAQTGALDVVSPLDYETTKEYTLRIRAQDGG
RPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDADAGDNARL
EYSLAGVGHDFPFTINNGTGWISVAAELDREEVDFYSFGVEARDHGTPALTASASVSVTI
LDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDAHSVITYQITSGNTRNRFSITS
QSGGGLVSLALPLDYKLERQYVLAVTASDGTRQDTAQIVVNVTDANTHRPVFQSSHYTVN
VNEDRPAGTTVVLISATDEDTGENARITYFMEDSIPQFRIDADTGAVTTQAELDYEDQVS
YTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQGSVYEDVPPFTSVLQISAT
DRDSGLNGRVFYTFQGGDDGDGDFIVESTSGIVRTLRRLDRENVAQYVLRAYAVDKGMPP
ARTPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIMYQI
VEGNIPEVFQLDIFSGELTALVDLDYEDRPEYVLVIQATSAPLVSRATVHVRLLDRNDNP
PVLGNFEILFNNYVTNRSSSFPGGAIGRVPAHDPDISDSLTYSFERGNELSLVLLNASTG
ELRLSRALDNNRPLEAIMSVLVSDGVHSVTAQCSLRVTIITDEMLTHSITLRLEDMSPER
FLSPLLGLFIQAVAATLATPPDHVVVFNVQRDTDAPGGHILNVSLSVGQPPGPGGGPPFL
PSEDLQERLYLNRSLLTAISAQRVLPFDDNICLREPCENYMRCVSVLRFDSSAPFIASSS
VLFRPIHPVGGLRCRCPPGFTGDYCETEVDLCYSRPCGPHGRCRSREGGYTCLCLDGYTG
EHCEASTHSGRCTPGVCKNGGTCVNLLVGGFKCDCPSGDFEKPFCQVTTRSFPARSFITF
RGLRQRFHFTLALSFATKERNGLLLYNGRFNEKHDFVALEVIQEQVQLTFSAGESTTTVS
PFVPGGVSDGQWHTVQLKYYNKPLLGQTGLPQGPSEQKVAVVSVDGCDTGVALRFGAMLG
NYSCAAQGTQGGSKKSLDLTGPLLLGGVPDLPESFPVRMRHFVGCMKDLQVDSRHIDMAD
FIANNGTVPGCPTKKIVCDSSICHNGGTCVNQWNAFSCECPLGFGGKSCAQEMANPQRFL
GSSLVAWHGLSLPISQPWHLSLMFRTRQADGVLLQAVTRGRSTITLQLRAGHVVLSVEGT
GLQASSLRLEPGRANDGDWHHAQLALGASGGPGHAILSFDYGQQKAEGNLGPRLHGLHLS
NITVGGVPGPASGVARGFRGCLQGVRVSETPEGISSLDPSRGESINVEPGCSWPDPCDSN
PCPTNSYCSNDWDSYSCSCVLGYYGDNCTNVCDLNPCEHQSVCTRKPNTPHGYICECLPN
YLGPYCETRIDQPCPRGWWGHPTCGPCNCDVSKGFDPDCNKTSGECHCKENHYRPPGSPT
CLLCDCYPTGSLSRVCDPEDGQCPCKPGVIGRQCDRCDNPFAEVTTNGCEVNYDSCPRAI
EAGIWWPRTRFGLPAAAPCPKGSFGTAVRHCDEHRGWLPPNLFNCTSVTFSELKGFAERL
QRNESGLDSGRSQRLALLLRNATQHTSGYFGSDVKVAYQLATRLLAHESAQRGFGLSATQ
DVHFTENLLRVGSALLDAANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPF
TIVTPNIVISVVRLDKGNFAGTKLPRYEALRGERPPDLETTVILPESVFREMPSMVRSAG
PGEAQETEELARRQRRHPELSQGEAVASVIIYHTLAGLLPHNYDPDKRSLRVPKRPVINT
PVVSISVHDDEELLPRALDKPVTVQFRLLETEERTKPICVFWNHSILVSGTGGWSARGCE
VVFRNESHVSCQCNHMTSFAVLMDMSRRENGEILPLKTLTYVALGVTLAALMLTFLFLTL
LRALRSNQHGIRRNLTAALGLAQLVFLLGINQADLPFACTVIAILLHFLYLCTFSWALLE
ALHLYRALTEVRDVNASPMRFYYMLGWGVPAFITGLAVGLDPEGYGNPDFCWLSVYDTLI
WSFAGPVAFAVSMSVFLYILSARASCAAQRQGFEKKGPVSGLRSSFTVLLLLSATWLLAL
LSVNSDTLLFHYLFAACNCVQGPFIFLSYVVLSKEVRKALKFACSRKPSPDPALTTKSTL
TSSYNCPSPYADGRLYQPYGDSAGSLHSASRSGKSQPSYIPFLLREESTLNPGQVPPGLG
DPSGLFLEGQAQQHDPDTDSDSDLSLEDDQSGSYASTHSSDSEEEEEEAAFPGEQGWDSL
LGPGAERLPLHSTPKDGGPGSGKVPWLGDFGTTTKENSGSGPLEERPRENGDALTREGSL
GPLPGPSTQPHKGILKKKCLPTISEKSSLLRLPLEQGTGSSRGSSISEGSRHGPPPRPPP
RQSLQEQLNGVMPVAMSIKAGTVDEDSSGSEFLFFNFLH
Download sequence
Identical sequences A2AEE7
ENSMUSP00000088046 NP_059088.2.92730 ENSMUSP00000088046 ENSMUSP00000088046 10090.ENSMUSP00000088046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]