SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000089284 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000089284
Domain Number 1 Region: 18-159
Classification Level Classification E-value
Superfamily TRAF domain-like 3.27e-37
Family MATH domain 0.0000276
Further Details:      
 
Domain Number 2 Region: 161-287
Classification Level Classification E-value
Superfamily POZ domain 9.42e-33
Family BTB/POZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000089284
Sequence length 340
Comment (Mus musculus)
Sequence
MSEDMEVTNWGYTHISVKEFCYVWTIRNFSPCIDGIRRTITSPVFSLEANDEVTWCLRAH
PNGVDEVSECYMSVFLELLSCRKSPVWAKYEFWITTSQGEKYQCMKSFNVHSFQKNQYRG
FKKFILGDFLISHPRRFLPENKLTLCCKVSIVGSVFGMPGQNITPAIKDPRHLLTDDLGE
LWENSLFTDCCLLVAGHEFRAHKAILAARSPVFRAMFEHEMEERLGNPTEIHDLDPKVFK
EMMGFIYTGKAPHLQSHSMATDVLTAADKYGLEGLKVLCEDALCRNLSVENAAQTLILAD
LHKREQLKTQALYFIALHASVVSETSEWKSMMETHPHLVG
Download sequence
Identical sequences E0CYU8
ENSMUSP00000089284 ENSMUSP00000096478 ENSMUSP00000089284 ENSMUSP00000096478 NP_001157203.1.92730 NP_997156.2.92730 10090.ENSMUSP00000089284 10090.ENSMUSP00000096478 ENSMUSP00000089284 ENSMUSP00000096478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]