SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000091317 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000091317
Domain Number 1 Region: 120-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.26e-158
Family Calponin-homology domain, CH-domain 0.0000000031
Further Details:      
 
Domain Number 2 Region: 5-95
Classification Level Classification E-value
Superfamily EF-hand 1.1e-18
Family Calmodulin-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000091317
Sequence length 630
Comment (Mus musculus)
Sequence
MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKIL
VVADNNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSSISSEGTQHSY
SEEEKVAFVNWINKALENDADCSHLLPMNPNDGSLFKSLADGILLCKMINLSEPDTIDER
AINKKKLTPFTVSENLNLALNSASAIGCTVVNIGAQDLKEGKPHLVLGLLWQIIKVGLFA
DIEISRNEALIALLKDGEDLEELMKLSPEELLLRWVNYHLTNAGWRTINNFSQDIKDSKA
YFHLLNQIAPKGDRDDGPAVAIDLSGFNEKNDLKRAGFMLQEADKLGCRQFVTPADVVSG
NPKLNLAFVANLFNTYPCLHKPDNNDIDLNLLEGESKEERTFRNWMNSLGVNPYINHLYS
DLADALVIFQLYEMIRVPVNWSQVNKPPYPALGGNMKKIENCNYAVELGKNEAKFSLVGI
AGQDLNEGNATLTLALVWQLMRRYTLKVLSDLGEGEKVTDDIIIKWVNQTLKSANKSTSI
SSFKDKSISTSLPVLDLIDAIAPNAVRQEMIKREHLTDEDKLNNAKYAISVARKIGARIY
ALPDDLVEVKPKMVMTVFACLMGKGLNRLK
Download sequence
Identical sequences Q3V0K9
ENSMUSP00000091317 ENSMUSP00000091317 ENSMUSP00000091317 10090.ENSMUSP00000091317 NP_001028382.1.92730 XP_006510809.1.92730 XP_006510810.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]